KEGG   Klebsiella michiganensis KCTC 1686: KOX_18850
Entry
KOX_18850         CDS       T01681                                 

Definition
(GenBank) type VI secretion system protein ImpL
  KO
K11891  type VI secretion system protein ImpL
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kox00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KOX_18850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_18850
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_18850
SSDB
Motif
Pfam: IcmF-related IcmF_C DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: AEX05492
UniProt: A0A0H3HDC0
Position
4073972..4075870
AA seq 632 aa
MMARPDKADAALYAQVMTTTAPSRPGLSPALWQSIAPDLHAFYMQSLPSQPAWKITPDRQ
LVTRVRQVLLEQIGRRNAESTLYENMLTRVRRSYADMTLEDMTPQTDAGRLFSTPESVPG
MFTRQAWEGGVQEAIDNAVASRRDEIDWVLSDSRKTLPGDVSPEALKQRLTARYFTDFAG
AWLNFLNSIRLNPAHNIADVTDQLTLAGDVRQSPLIALMNTLAYQGQTGQQKEAISASLV
KSAKNLLGGDDRPVIDQQAAGPAGPLDSTFGPLLQLMGKNSAQSVMAADSSLSLQTYLTR
LTRVRLRLQQVANAADPQAMMQQLAQTVFQGRSVDLTDTQEYGSLVAASLGEEWSGFGQT
MFVQPLTQAWETVLQPSAASLNEAWQRSVVANWNSAFKGRYPFAAAKSDASLPMLAAFIR
RDTGRIDRFLSTQLGGVLHREGSTWVADRTHSQGLTFSPAFLNAVNQLSQLSDILFTDGS
QGISFELQGVAMPEVVETQLTLDGQKLHYFNQVADWQSFRWPGVINKPGAMLTWTSTAAG
TRLYTNHSGPWGVIRMLEQMQRQKAGDGLYRLSVTAPDRRQLQWLLRTELGDGPLALLKL
RNFSLPSQIFSVGVPAPGRTDEYESDVVEGSE
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgatggcgcgcccggacaaagccgacgctgccctgtacgcgcaggtgatgacaaccacc
gcgccatcccgtccgggactctccccggcgctgtggcagagtatcgccccggaccttcac
gccttttacatgcagagcctgccgtcgcagccagcctggaaaatcacgccggacaggcag
ctggtcacccgggtacgtcaggtgctgctggagcagattggccggcgcaacgcggaaagt
acgctgtatgagaacatgctcacccgggtgcgccgcagctacgcggacatgacgctggag
gacatgacgccgcagaccgacgccggtcgcctgttcagcacgccggagtcggtgccgggg
atgttcacccgccaggcgtgggagggcggggttcaggaagccattgataacgccgtggcg
tcccggcgcgatgaaatcgactgggtgctgagcgatagccgtaaaacgctgcccggcgac
gtctccccggaggcgctgaagcagcgcctgacggcgcgctacttcaccgattttgccggt
gcctggctgaacttcctcaacagtatccggctgaacccggcgcacaatattgccgacgtc
accgaccagttaacgctggccggggacgtgcgccagtcgccgctgattgccctgatgaac
accctggcttaccaggggcagaccgggcagcagaaagaggccatttccgcatcgctggtg
aaatcggcgaaaaacctgctgggcggtgatgaccggccggtgattgaccagcaggccgcc
ggaccggcggggccgctggacagcaccttcgggccgctgctgcagcttatgggtaaaaac
agcgcgcagagcgtgatggcggcggacagttcgctcagtttacagacttacctgacgcgt
ctgacccgcgtgcgcctcaggctccagcaggtggcaaacgccgccgacccgcaggcgatg
atgcagcagctggcgcagacggtcttccagggcaggagcgttgacctgaccgacacgcag
gagtacggcagcctggtggcggcaagcctcggtgaagagtggagcggtttcgggcagacg
atgtttgttcagccgctgacccaggcctgggagacggtgcttcagccgtcggcggccagc
ctgaacgaagcgtggcagcgctcagttgtcgcgaactggaattcagcgtttaaggggcgt
tatccctttgctgccgcgaagagcgacgcctcgctgccgatgctggcggcgttcatccgc
cgcgataccggacgtattgaccgtttcctcagcacgcagctgggcggcgttctgcaccgg
gagggcagcacctgggtggcggacagaacccacagccaggggttgacgttcagcccggcc
ttcctgaacgcggtgaaccagctcagccagctgtccgacatcctgtttaccgacggcagc
cagggtatcagctttgaactgcagggggtggcgatgccggaagtggtggaaacacagctg
acgcttgacgggcagaaactccactattttaaccaggttgccgactggcagagcttccgc
tggccgggggtaatcaataaaccgggggcgatgctgacctggacgtcgacggcggcggga
acccgtctgtatacaaaccacagtggtccgtggggcgttatccggatgctggagcagatg
cagcggcagaaagcgggggacgggctgtaccggctgagcgtcaccgcgccggacaggcga
cagcttcagtggctgctgcgtacggaactgggcgacggaccgctggcgctgctgaagctg
cgaaacttcagtctgccgtcgcagatattcagcgtcggtgtcccggcgccaggccgcacg
gatgaatatgaatctgacgttgtggaagggagtgaataa

DBGET integrated database retrieval system