KEGG   Klebsiella michiganensis KCTC 1686: KOX_19535Help
Entry
KOX_19535         CDS       T01681                                 

Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00620  Pyruvate metabolism
kox00630  Glyoxylate and dicarboxylate metabolism
kox01100  Metabolic pathways
kox01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KOX_19535
   00630 Glyoxylate and dicarboxylate metabolism
    KOX_19535
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     KOX_19535
    1.2.1.22  lactaldehyde dehydrogenase
     KOX_19535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AEX05629
UniProt: A0A0H3HB58
Position
4225910..4227349
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMYIDGQFEPGRGDAWIDVINPATEALLSRIPDGSAEDARRAILAAERAQPGW
EALPAIERAGWLRKIAAGIRERAEEIAALIVAEGGKIQQLAAVEVSFTADYLDYMAEWAR
RYEGEIVQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAQIVHDIGLPKGVFNLVLGRGETVGQELASNPKVAMVSMTGSVAAGEKIMAA
AAKNITKVCLELGGKAPAIVMDDADLELAVKAVVDSRVINSGQVCNCVERVYVQKGIYDR
FVNRLGEALKAVQFGDPASRDDIAMGPLINAAALERVEQKVAKAVAQGARVVLGGKAVTG
KGYFYPPTLLLDVRQEMDIVHEETFGPVLPVVAFDTLEEALAMANDCDYGLTSSIYTRDL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLNEYLQTQVVYLQA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgttcaacaccctatgtatattgacggccagtttgaacccggccgcggt
gatgcatggattgatgtgatcaatccggcgacggaagcgctgctttcgcgtattcccgac
ggcagcgcggaagatgcccggcgcgcgattctggccgctgagcgcgcgcagccgggctgg
gaagccctgccggcgattgagcgagcggggtggctgcgcaaaatcgctgccggtatccgc
gagcgggccgaggagatcgccgcgctgatcgtcgccgagggcggaaaaatacagcagctg
gccgcggtggaggtctcctttaccgccgattatctggattatatggccgaatgggcgcgc
cgttatgaaggtgaaattgtacagagcgaccggccgggggaaaatattctggtattcaag
cgcgcgctgggcgtgaccaccggcattctgccgtggaattttccgttcttcctgattgcc
cgcaagctggcgccggcgctcattaccggtaataccatcgtgattaaaccgagtgaattt
acgccgaataacgccatcgcttttgcgcaaatcgtccatgatatcggcctgccgaaaggg
gtctttaacctggtgctggggcgcggcgaaaccgtgggccaggagctggcgagcaatccg
aaagtggcgatggtcagcatgaccggcagcgtcgccgcgggcgagaagattatggccgcg
gcggcgaaaaacatcaccaaagtgtgtctggagctgggcggtaaagcgcccgctatcgtg
atggacgatgcggatcttgagctggcggttaaggcagtggtggattctcgcgtcattaat
agcgggcaggtgtgtaactgcgttgagcgcgtctatgtgcaaaagggcatttacgatcgc
ttcgttaaccgtctgggtgaagcgctgaaggcggtgcagtttggcgatccggcgtctcgc
gacgatatcgcaatgggaccgttgattaacgccgccgcgctggagcgcgtggagcagaag
gtggcgaaagcggtggcccagggcgcgcgcgttgtcctgggtgggaaagcggtgacgggt
aagggctatttctatccgccgacgctgctgctggacgtgcgccaggagatggatatcgtg
catgaagagacgttcggcccggtgctgccggtggtggcgtttgatacccttgaagaagcg
ctggcgatggccaacgactgcgattacgggctgacgtcgtcaatctatacccgcgatttg
aacgtcgcgatgaaggcgatcaaagggttgaagtttggtgaaacctatattaaccgcgag
aatttcgaagcgatgcagggtttccatgccggatggcgtaaatcgggcatcggcggcgcc
gacgggcgtcatggtctgaatgagtatctgcaaacccaggtggtctatctgcaggcctga

DBGET integrated database retrieval system