KEGG   Klebsiella michiganensis KCTC 1686: KOX_22405Help
Entry
KOX_22405         CDS       T01681                                 

Definition
(GenBank) type VI secretion system protein ImpH
  KO
K11895  type VI secretion system protein ImpH
Organism
kox  Klebsiella michiganensis KCTC 1686
Brite
KEGG Orthology (KO) [BR:kox00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_22405
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_22405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AEX06201
UniProt: A0A0H3HHZ3
Position
complement(4819858..4820943)
Genome map
AA seq 361 aa AA seqDB search
MGREAQPPHSRLSPRLAADLHRMNFYRFCQLLEKRNPDRPLMGSTSHPADDPVRFAPHPG
MGFPGSELKAVEYDEDDDSRPPLIRTTFMGMYGVDSPLPTAYLDDITQCREGHEVLQGFL
DIFSHRILTQFYRIWRKYSYPATFEAGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLA
LLGVLRQPGKTQEGMQALVRLLAPDTTVQVSPYCLRPVEIGQPLGFYGDDDFLLDGNTPL
GEEAMDAGSQLLVALRTDNEQEAQGWKPDGLLYQDFLVMLRVYLGWRFKARITLTTRTRL
LAVPPLGEEPFWLGMNGVLGAEEGAFADDLPLTFTTELGYYTGLAPAKPQQGNRRAKYKF
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagaagcacaaccgccgcattcccggctgagcccgcggctggcagccgacctg
caccgcatgaatttttatcgcttctgccagcttctggagaagcgtaatccggacaggccg
ctgatggggtcaaccagccaccctgctgatgacccggtgcggtttgcgccgcatccgggg
atggggtttccgggcagcgaactgaaagctgtcgaatatgacgaggatgatgacagcagg
ccaccgctcatccgcacaacctttatggggatgtacggtgtcgactcacccctgccgaca
gcctatcttgatgacatcactcagtgccgtgaagggcatgaggtgctacagggctttctg
gatatcttcagccaccgcatcctgacgcagttttaccgcatctggcggaaatactcttat
ccggccacgtttgaggcagggggaactgacagcatttcgcagtcgctgctgggtctggtg
gggctgggcataccgggaaccgcaaaccacatcgccacaccggtatcccgctttctggcg
ctgctcggtgtgctgcgccaacccggcaaaacccaggaggggatgcaggcgctggtgaga
ctgctggccccggatactacggtgcaggtgagtccgtactgcctgcggccggtggagatc
ggccagccgctgggtttttacggcgatgacgattttctgctggacggcaatacgccgctg
ggggaagaagcgatggatgcgggcagtcaactgctggttgcgctcaggacggataacgaa
caggaagcgcagggctggaaaccggatggtctgctgtatcaggattttctggtgatgctg
cgtgtttatctcggctggcgttttaaggccaggatcaccctgaccacccggacccgactg
ctggccgtcccgccgctcggcgaagaacctttctggctcggcatgaacggcgtgctggga
gcggaggagggggcgtttgcggacgatctcccgctgacctttacgacagaactgggttac
tacaccgggctggcgcctgcgaaaccacaacaaggaaatcgacgtgctaagtacaaattt
gattaa

DBGET integrated database retrieval system