KEGG   Klebsiella michiganensis KCTC 1686: KOX_22510Help
Entry
KOX_22510         CDS       T01681                                 

Definition
(GenBank) Hypothetical Protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kox00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KOX_22510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_22510
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_22510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEX06222
UniProt: A0A0H3HAC3
Position
complement(4846160..4846510)
Genome map
AA seq 116 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVSP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggtgcggacattaaaggatct
gtggacgttcaggatcgcgagggcagcatcgaagttgtcgctcaggagcataacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacccgtatccacacgccgttcctg
ttcaccaaggaaatcgactcgtccagcccgtatctgtacaaggcggtgaccaccggtcag
accctcaagtctgcggaattcaagtggtacaagatcaacgacgcgggccaggaagtggag
tacttcaacaccaaactcgaaaacgtgaaggtggtgaaagtgagcccctga

DBGET integrated database retrieval system