KEGG   Klebsiella michiganensis KCTC 1686: KOX_22525
Entry
KOX_22525         CDS       T01681                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
kox  Klebsiella michiganensis KCTC 1686
Brite
KEGG Orthology (KO) [BR:kox00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_22525
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_22525
SSDB
Motif
Pfam: T6SS_VasE CortBP2
Other DBs
NCBI-ProteinID: AEX06225
UniProt: A0A0H3HCP4
Position
complement(4848910..4850250)
AA seq 446 aa
MKTEQPLWGRGVMVSPQHFQQQAAYSAWSAECIARLGLSHPWGMIDATFESDALKLGRLQ
ARHLHIRFPDGTLIDTDNADDLPPVLALENESQHVVVVLALPLLRANGGNCLKPDEVAER
PVRYRQRWRDVRNAFGEDTRQIAVMRPELTLRFAHQNNSDYLTCPIARLQQDSQRAWQLD
ETFLPPLLAIQGSRWLMTQLEQLMTQLRTRLSRLMDMRRESNERMADFAVADVSLFWLLN
ALNSAEPVLGQFQRHPQNPPERLYPELARLAGSLLTFSLEHQVSAIPVWQHEQLNNVFPP
LFDLLGDLLEASLPSRVVAIELEHDARLHFWQARLHDPRLREGADYYLSVRSRMSAAQLQ
EQFPRQCKIGSPDHVRSIVNSSRVGVPLAPLRHVPAAIPLRLENQYFSLDVSHPLTTEML
QSGTCMFYVPGMLGEPELEFFAVLRT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaaacggaacaaccgttatggggcaggggcgttatggtctctccccagcacttccag
cagcaggccgcgtattcagcctggtctgcggaatgtatcgcccgactcgggctttctcat
ccctgggggatgatcgatgccacattcgaatcggatgcactgaaactgggccgcctgcag
gcccgtcatctgcatatccgtttccccgacgggacattaatcgatacggataacgctgac
gatttgccaccggtactggcgcttgagaatgaatcacagcacgtggtggtggtactggcc
cttccgctgctgcgggcgaacggcggcaactgcctgaaacccgatgaggtggctgagcgt
cctgttcgctatcggcagcgctggcgggatgtccgcaacgcctttggggaagatacccgc
cagattgcggtgatgcgcccggagctgacgctgcgtttcgcccatcagaataacagcgat
tacctgacctgtccgatcgcccgcctgcagcaggattcgcagagggcgtggcaacttgat
gagacgtttcttcccccgctcctggccatccagggtagccgctggctgatgacccaactg
gagcaactgatgacccagttgcgtacccgcctgagccgcctgatggatatgcgcagggaa
agcaacgaacggatggcggattttgccgtggccgatgtgtccctgttctggttgctcaat
gctctgaacagcgctgagcccgtgctcggacagtttcagcgccatccgcaaaacccaccg
gagcgtctgtatccggagctggcccgtctggcgggcagcctgctgaccttctcgctggag
caccaggtgagtgcgatcccggtctggcagcatgagcaactgaataacgttttcccgccg
ctgtttgatttactgggtgacctgctggaagccagcctgccgtcgcgggtggtggcgatt
gaacttgagcacgatgcccggctgcacttctggcaggcccgtctgcatgacccgcgtctg
cgtgaaggggcggattactacctgtccgtgcgttcgcggatgtcggcggcacagctgcag
gagcagttcccgcgtcagtgcaagatcggcagtcccgatcatgtcagaagtatcgtcaac
tcatcgcgggtgggcgtacctctcgcgccactgcgtcatgtaccggcagccattccactg
cgtctggaaaaccagtacttcagccttgatgtctctcaccccctgaccaccgaaatgctc
cagagcggcacatgtatgttttacgttccgggaatgctcggcgagcctgaacttgaattc
tttgcggtactgagaacatga

DBGET integrated database retrieval system