KEGG   Klebsiella michiganensis KCTC 1686: KOX_25955
Entry
KOX_25955         CDS       T01681                                 

Definition
(GenBank) type VI secretion system protein ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
kox  Klebsiella michiganensis KCTC 1686
Brite
KEGG Orthology (KO) [BR:kox00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_25955
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_25955
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEX06902
UniProt: A0A0H3HCI7
Position
complement(5600177..5601940)
AA seq 587 aa
MKDQTLRYFDAEMRYLREAAKEFAQTHPDRAAMLDLDKAGTPDPYVERLFEGFAFSMGRL
REKIDDDLPELTEGLVSMLWPHYLRTIPSLSVVALTPALHAMKMAEVVPAGLEVYSRPVG
PKNTVCRYRTTQDVMLNPLSVSAVTMTTEPDGRSLLRMRMACSSQADWSHADLSRLSLYL
GADAPVSSQLHLMLTKRQAALYMRLPGQTDRIRLDGYFSPGGFSEEDGLWPKGDTAFSGY
QLLLEYFTFRDKFMFVHFNGLDGITPPAGTEYFDIEVVFSTPWPSDLPVTDDAVRLHCVP
VINLFTLEADPLTITGLESEYLLRPKRLQDGHTEIYSVDSVTGSNRTNDAEYVPFSSFRH
KGGMMRRQAPPRYYHTRVKRSVTGLYDTWLILGGHQWEDDRLLDREAVSLQITGTNGQLP
RRALQSTLLDRCEQVVSTPLSVRNLCKPTLPVYPPAEDRFHWRVLSHLGSGFLNMLSTAE
VLRGTLALYNWQEDELNTRRLEAIQHVEHHRLQRFEQGYLLRGLDIEVTLDSNGFTGEGD
IHLFGEMLNRFFALYVDMNQFNQLTLIVQPEGKCIRWKENHSPRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgaaagatcagaccctgcgctattttgatgcagaaatgcgctacctgcgtgaagccgca
aaagagttcgcgcaaacccatcccgatcgtgcagcgatgctcgacctggataaagctggt
acaccggatccgtatgtcgaacgcctgtttgaaggctttgctttctcgatgggacggctg
cgcgaaaagattgacgacgacctgccggaactcaccgaagggctggtcagtatgctctgg
ccgcattacctgcgtaccattccgtcgctttcggtggtggcacttaccccagcgctgcat
gccatgaaaatggccgaagtcgtgcccgcggggttggaggtgtactcccgcccggtgggg
ccgaagaacacggtctgtcgttaccgtacgacccaggatgtaatgctcaatcccctgagt
gtctcagcggtcaccatgaccaccgaacctgacggacgttcgctgttgcggatgcgcatg
gcctgcagtagtcaggcggactggtcgcatgccgacctcagccgcctgagcctctatctc
ggcgcagatgcacccgtcagcagtcagctgcacctgatgctcacgaaacgacaggctgcc
ctgtatatgcgtctgcccgggcagaccgatcgtatccggcttgacgggtacttctcgccg
ggaggattttcggaggaagacgggctgtggccgaagggggataccgccttcagcggctac
cagttgttgctggagtacttcaccttccgcgacaagtttatgtttgtccactttaatggc
ctggacggcatcacgccgcctgccgggacagagtacttcgacattgaagtggtattcagc
acgccgtggccgtctgatctgccggtcaccgatgacgcggttcgactgcactgcgtgccg
gtgattaatctgttcaccctggaggcggacccgctcaccattacgggcctggaaagtgag
tacctgctgcgccccaaacggctgcaggacggacacaccgagatttactccgtggattcg
gtcaccggctcaaaccggacgaacgacgcggagtatgtgccgttcagctccttccgccat
aaaggcgggatgatgcgccgccaggcaccaccgcgttactaccatacccgcgtgaagcgc
agtgtgaccgggctgtatgacacctggcttatcctcggcggtcaccagtgggaagatgac
cgcctccttgaccgcgaagccgtgtcgctacaaatcaccggcaccaacggtcagttacca
cgccgggcattgcagagcacgctgctggatcgctgtgagcaggtggtcagtacaccgctt
tcagtacgcaacctctgcaaaccgacgctgccggtctacccgcctgcggaagaccgattc
cactggcgggtgctgagccacctgggctccggattcctgaatatgctgagtaccgctgaa
gtgctgcgcgggacgcttgcgctctataactggcaggaagatgaactgaacacccggcgt
ctggaggctattcagcatgtggagcatcaccgccttcagcgctttgagcagggctacctg
ctacggggcctggatatcgaagtgaccctcgacagcaatggttttaccggtgagggcgat
attcatctgtttggtgaaatgcttaaccggttttttgcgttgtatgtcgatatgaaccag
ttcaaccagcttaccctcatcgttcagccagaaggaaaatgcatccggtggaaagagaat
cacagtccgcgcctgccaggctga

DBGET integrated database retrieval system