KEGG   Klebsiella michiganensis KCTC 1686: KOX_25975Help
Entry
KOX_25975         CDS       T01681                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kox00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KOX_25975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_25975
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_25975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AEX06906
UniProt: A0A0H3HJX7
Position
complement(5603309..5606728)
Genome map
AA seq 1139 aa AA seqDB search
MVKDNSVWRGNWGRISITALIAAAIGLAIWKKGDAFGLTSNSLKLLVSVAVIILLLLVRH
GKTISLAIKQQWSRFQAKRKSLLPADEGRVKQTPPRNVTVDTIRAAMRNLYGRRWGRKTR
ILLVTGTVSEVEQLTPGLTTQLWQEDRGTLLLWGGDLSTPADSAWLTALRKLRRRPVDGM
VWVTSAFDQLSAPGLEQPLPVPSDSTMDFLSHAISIRMEALGWQLPLYVWSLHPRAGKPE
GRITQATGCLLPAGCSTEGLAEQLSALTPDLTSQGLQQTCGEVKHNFLLTLADQLIREPE
SVTAPLSVILNPYRPLLLAGVVFSQPSAGAERAVPHHWGMDKRWDALPESVRTLPAGLRP
YKPGIPWRRVMASVVALTMVGWAAWMGIAYVTNRSQIDSANVQAALAARQNQPLEQRLHA
LSELQKTLSRLQYRSEFGVPWYEQAGLSQNNALLDALWPRYQDSALPLLRDAAADHLQRQ
LNAFNVLPAGSPLREQMAKNTYDQLKLYLMLARPEHMDAAWFGSALLNDWPMRDGVKNGV
WLGMAPSLLSFYGVQLVAHPEWKLRADENLVSQARSLLVRLMGVRNSESTLYQKMLTQVS
HLYVDMRLEDMTGDTDASRLFSTTEVVPGMFTRQAWEQAVQPAIEKVVKARRDGLDWVLT
DSKRQMNKQDETSPEALKHRLTERYFADFSGAWLEFLNSLRWNQATTLSDSIDQLTLMAD
VRQSPLVALMNTLNVQGRTGQTGEAISDSLVKSAKNLLGGDNQDAIDQSAGVHGPLDATF
GPVLALMDKNRTGAQELSLQSFLTRVTQVRLRLQQVTNAADPQAMTQTLAQTVFQGKSVD
LTETRDYGSLIAAGLGLEWSGFGRTVFVQPMEQAWQQVLTPAAESLNAQWQQAVVAEWNS
AFGGRYPFNNSSSDVSLPLLAKYLNADSGRIAQFLQTRLRGVLHKEGNHWVPDSINSQGL
AFNPAFLNAINTLSHISDVAFTEGSAGMNFELRPGTADGVMQTDMIIDSQKLIYVNQLPA
WKRFAWPADTEAPGANLSWVSTQAGTRQYADIPGAWGWIRLLDKAVVSAYPGVGSSYSLS
WKAQDGRTLNYTLRTEAGEGPLALLKLRNFRLPETIFSTTGVAESGLVASEASEVEEVY
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggataactcagtgtggcgtggtaactggggacgcatcagtattactgcactg
attgctgccgcgatcggattagctatctggaaaaagggcgatgcgttcggacttaccagt
aatagccttaaactgctggtatctgtggcggtgataattcttctgctacttgtccgccat
ggcaaaactattagcctggcgattaaacaacagtggtcgcgttttcaggcgaagcgtaaa
agtctcctgcctgctgatgaaggtcgcgttaagcagacaccgccacgcaatgtcaccgtt
gataccatccgtgcagccatgcgtaacctctatggtcgtcgctggggccgtaaaacacgc
atcctgctggtcactggcactgtatctgaggtggagcaactgaccccagggctcacgact
cagctctggcaggaagatcgcggcacgctgttactgtggggcggtgacctcagtacgcca
gccgacagtgcctggcttaccgcgctgcgcaaactgcgccgccgtccggtggatggcatg
gtatgggtcacttcagcgtttgaccagctctcagcgccagggctggagcagccgctgccg
gtaccttcagacagcaccatggatttcctgtctcacgccatcagcatacgtatggaagcg
cttggctggcagctcccgctgtatgtctggtccctgcacccacgcgccggtaaaccggaa
gggcgcattacgcaggcaaccggctgtttgttacctgccggttgcagtaccgaagggctg
gcagagcaactgtccgccctgacgccagatttgacttcacaggggctgcagcagacctgc
ggtgaagtgaaacataacttcctgctgacgcttgccgaccagctcattcgtgagccggaa
agcgtgaccgcaccgctgtcggtgatactcaatccgtaccgtccgcttctactggccggc
gtggtgttcagtcagccttcagccggtgccgaacgtgccgtgccgcaccactggggcatg
gataagcgctgggatgccctgccggagtctgtccggacactccctgccggactacgtccg
tacaagcccggcattccgtggcgcagggtgatggcgtctgttgttgctcttacgatggtc
ggctgggctgcgtggatgggcatcgcgtatgtcaccaaccgcagccagattgacagcgct
aatgtccaggcggcacttgccgcccgacagaatcagcccctggagcagcgcctgcacgcg
ctgtctgaactgcaaaaaacgctgtcccgtctgcagtaccgctctgagtttggcgtgccg
tggtacgagcaggccggactaagccagaacaatgcgttgctggacgcactctggccacgt
taccaggacagcgcattgccgctgctgcgggatgccgccgctgaccatctgcagagacaa
cttaatgcctttaatgtattgccagcgggcagcccgctgcgtgagcagatggcaaaaaac
acttatgaccagctcaaactctacctgatgctggcgcgtccggaacatatggacgcggcc
tggttcggctctgcattgctgaatgactggccgatgcgtgacggtgtaaaaaacggcgtc
tggctggggatggcgccttctctgctgtcgttttatggcgtgcagctggttgcgcaccct
gaatggaaactgcgtgctgatgaaaatctggtcagccaggcgcgttccctgctggttcgt
ctgatgggcgtacgcaacagcgaatcgaccctgtaccagaagatgctcactcaggtgtcg
cacctctatgtcgatatgcgcctggaagacatgaccggcgataccgatgcatcccgtctg
ttcagcaccacggaagtcgtgcccgggatgtttacgcgtcaggcctgggagcaggccgtg
cagcccgctatcgagaaggtggtgaaggcacgccgggacggactagactgggtgctgact
gacagcaagcgtcagatgaataaacaggacgagacctcaccggaagctctgaaacatcgc
ctgacggaacgttactttgccgacttcagcggggcatggcttgagttcctcaacagcctg
cgctggaaccaggcgaccacgctgtcggattccattgaccagttgaccctgatggccgac
gtgcgtcagtcaccactggtggcgctgatgaacaccctgaatgtgcagggacgcaccggg
cagacaggcgaagccatttcggattcgctggtgaaatcggcgaagaatctgctcggcggt
gataaccaggatgccattgatcagagcgctggtgttcacggcccgctggatgcaaccttt
ggtccggtactggcgctgatggacaaaaaccggacaggtgcacaggagttgagtctgcag
tcgttcctgacccgcgtgacgcaggtgcgtctgcgcctgcagcaggtgaccaatgccgcc
gacccgcaggcgatgacacagacgctggcgcagaccgtatttcagggtaagtcggtcgac
ctcaccgaaacccgtgactacggcagcctgattgccgccggtctcggcctggagtggagc
ggctttggccgtaccgtgtttgttcagccgatggagcaggcctggcagcaggtactgacc
ccggcggccgaaagtctcaatgcccagtggcagcaggccgtggttgctgagtggaacagt
gccttcggtggacgctatccgtttaacaattccagcagtgatgtatccctgccgctgctg
gctaaatacctcaatgcagattccgggcgtattgcgcagttcctgcaaacccgcctcaga
ggcgtgctgcacaaagagggcaaccactgggtgccggacagcatcaactcgcaggggctg
gcctttaatccggcgttcctcaatgccatcaacaccctgagccatatctcggatgtcgct
ttcaccgaaggcagtgccggcatgaacttcgagttgcgtccgggcactgccgatggggta
atgcagactgacatgattatcgacagccagaagctgatctatgtaaaccagttgccggcg
tggaagcgcttcgcctggcctgcagataccgaggctccgggggcgaacctgagctgggta
agcacgcaggcaggaacccgtcagtacgccgatatccctggcgcctggggctggatacgt
ctgctcgataaagctgtggtcagtgcttatccgggcgttggtagcagttacagcctgagc
tggaaagcacaggacgggcgcacgctcaattacaccctgcgtaccgaggcgggcgagggg
ccactggcgctgctgaaactgcgcaacttccgtctgccggagacgattttcagcacgact
ggcgtggccgaatcaggcctggtcgccagcgaggccagcgaagtagaagaggtctactga

DBGET integrated database retrieval system