KEGG   Klebsiella michiganensis KCTC 1686: KOX_26055Help
Entry
KOX_26055         CDS       T01681                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
kox  Klebsiella michiganensis KCTC 1686
Brite
KEGG Orthology (KO) [BR:kox00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_26055
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_26055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA GerD
Motif
Other DBs
NCBI-ProteinID: AEX06920
UniProt: A0A0H3HEM9
Position
complement(5622272..5622769)
Genome map
AA seq 165 aa AA seqDB search
MSESFQNEIPRARVNIKLDLVTGGARKKVELPLKLLTVGDYSNGRAEGTLSEREKININK
NNFNSVLADLHPEVNITVKNTLANDGSEENVKLLFQNMKDFEPEAVARQIPQLRAMLAMR
NLLRDLKSNLLDNVTFRKELETILKDPALTDELRRELNALAPVQG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcatttcagaacgagataccccgcgcgcgcgtaaatataaaactggatctg
gtcacgggcggtgccaggaagaaagttgaactgccgctgaagctgctgactgtcggcgat
tacagcaatggcagggcggaggggaccctttcagagcgcgaaaaaatcaacatcaataaa
aataacttcaacagcgttctcgctgatctccatcccgaagtaaatatcaccgttaaaaat
accctggcaaacgatggctccgaagaaaacgtgaagctgctttttcagaatatgaaggat
tttgagccagaggcggtggcacgtcaaatacctcagctccgtgcgatgctcgctatgcgt
aatttactgcgtgatttgaaatccaatcttctggataatgtcactttcaggaaagaactg
gaaactattttaaaggacccggcacttactgatgaacttcgccgcgaactgaatgcgctt
gccccggtacagggataa

DBGET integrated database retrieval system