KEGG   Klebsiella michiganensis HKOPL1: J415_01705Help
Entry
J415_01705        CDS       T03188                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00620  Pyruvate metabolism
koy00630  Glyoxylate and dicarboxylate metabolism
koy01100  Metabolic pathways
koy01110  Biosynthesis of secondary metabolites
koy01120  Microbial metabolism in diverse environments
koy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J415_01705
   00630 Glyoxylate and dicarboxylate metabolism
    J415_01705
Enzymes [BR:koy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     J415_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AHW85907
Position
complement(365896..367497)
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGDQEKQILTPEAVEFLTELVRRFTPERNKLLAARIQQQQAIDN
GKLPDFISETDSIRSGDWKIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPALLICRVRGLHLPEKHVTWR
REAIPGSLFDFALYFFHNYKALLEKGSGPYFYLPKTQAWQEAAWWSEVFSFTEDRFELPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNGVLGENKNQLSVTREDDAPITAEQLLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGTPVTKALFR
QWLAEEMRVIQDELGEHRYSSGRFDEAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcactgacgaactggcttttagccagccatatggcgaccag
gagaagcaaatcttaacgcctgaggccgtagaatttctgaccgagctggtgcgccgcttt
acgcctgagcgcaataaactcctggccgcgcgtatccagcagcagcaggcaattgataac
ggcaagcttcccgattttatttcggaaacggattccattcgtagcggtgattggaagatc
cgcggcattccggacgatttgcaggatcggcgggtagaaattaccggtccggtagagcgc
aagatggtcatcaatgcgctcaatgcgaatgtaaaagtctttatggcggatttcgaagac
tcactggcgcccgaatggagcaaagtcattgatgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctacaccaatgaagccggcaagatttatcagctgaagccgaacccg
gcgctgctgatctgccgcgtgcgcggtctgcatctgccggaaaaacacgtgacgtggcgc
agggaagcgattcccggcagtctgttcgacttcgccctctatttcttccacaactacaaa
gcgttactggaaaaaggcagcggcccctatttctatctgccgaagactcaggcctggcag
gaagccgcgtggtggagtgaagtatttagctttacggaagaccgttttgagctgccgcgc
ggcaccatcaaagccacgctgctgatcgaaacgctgcccgccgtattccagatggacgaa
attctgcacgccctgcgcgaccatattgtgggtctgaactgcgggcgctgggactacatc
ttcagctatatcaaaacgctgaagaatcatccggatcgcgttctgccggaccgtcaggtg
gtgacgatggacaagcctttcctcagcgcctactcgcgattgttgattaagacctgccac
aggcgcggcgcgtttgcgatgggcggcatggcggcctttattccgagcaaagatgccgag
cgaaacaaccaggtgctgaacaaggtaaaagcggacaaatcgctggaggcgaataacggt
catgacggtacctggatcgcgcatcccgggctggctgacaccgcgatggccgtctttaac
ggcgtactgggcgagaacaaaaatcagctgtccgttacccgcgaagacgatgcgccgatt
accgctgaacagctgttggctccctgcgagggcgaacgaaccgaagagggcatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaggcgtggatttccggcaacggctgcgtaccg
atttatggcctgatggaagatgcggcgacggcggaaatctcccgtacctctatctggcaa
tggatccaccatgagaaaaccctcagtaacggcacaccggtcaccaaagcgctgttccgc
cagtggctggccgaagagatgcgggtgattcaggacgaactgggcgagcaccgctacagc
agcgggcgttttgatgaagccgctcgcctgatggaacagatcaccacctccgacgagctg
attgatttcttaaccctgccgggctaccgccttctggcctaa

DBGET integrated database retrieval system