KEGG   Klebsiella michiganensis HKOPL1: J415_07900Help
Entry
J415_07900        CDS       T03188                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00071  Fatty acid degradation
koy00280  Valine, leucine and isoleucine degradation
koy00310  Lysine degradation
koy00362  Benzoate degradation
koy00380  Tryptophan metabolism
koy00620  Pyruvate metabolism
koy00630  Glyoxylate and dicarboxylate metabolism
koy00640  Propanoate metabolism
koy00650  Butanoate metabolism
koy00900  Terpenoid backbone biosynthesis
koy01100  Metabolic pathways
koy01110  Biosynthesis of secondary metabolites
koy01120  Microbial metabolism in diverse environments
koy01130  Biosynthesis of antibiotics
koy01200  Carbon metabolism
koy01212  Fatty acid metabolism
koy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J415_07900
   00630 Glyoxylate and dicarboxylate metabolism
    J415_07900
   00640 Propanoate metabolism
    J415_07900
   00650 Butanoate metabolism
    J415_07900
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J415_07900
   00072 Synthesis and degradation of ketone bodies
    J415_07900
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J415_07900
   00310 Lysine degradation
    J415_07900
   00380 Tryptophan metabolism
    J415_07900
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J415_07900
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J415_07900
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J415_07900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:koy04147]
    J415_07900
Enzymes [BR:koy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J415_07900
Exosome [BR:koy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J415_07900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHW87117
Position
1671481..1672659
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVVKALVERSGVDPQSIDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQHKARRAIDSGRFRDEIVPVTSKLNGTPRLVDTDEQPRVDPSAEALASLLPTFDQQGS
VTAGNASSINDGAAAVMMMSEAKAEELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWKLDEVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtaatcgtcggcgcgttgcgaacgccaatcggctgttttcagggcgcg
ctgtcgcgtcattcggcggtggagctgggcagtgtggtggtgaaggcgcttgttgagcgc
agcggcgtcgatccgcaaagtattgatgaggtgatcctcggccaggtgctgacggcagga
accggacagaatccggcgcgtcagtcggcgatccgcggcgggctgcctaataccgtttct
gctattaccatcaacgacgtctgcggttccggactgaaggcgctgcacctggcgacccag
gcgattcagtgcggcgaagcggacgtagtgatcgccggcgggcaggagaatatgagccgc
gcccctcacgtgctgaccgacagccgtaccggcgcccagttgggcaatagccagcttatc
gacagccttgtccacgatggcctgtgggatgcgtttaacgactaccatatgggcgtgacg
gcggagaacctggcgcgcgagtatggcatcagccgtgaactgcaggatgcgtgggcgctt
agctcgcagcacaaagcgcggcgggcgattgattccggacgctttcgcgatgaaatcgtg
ccggtgaccagcaaactcaacggtactccgcgcctggtggataccgatgagcagccgcgc
gtcgaccccagcgcagaagcgctggccagcctgctgccgacctttgaccagcagggctcg
gtcaccgccggcaatgcctcaagcattaacgatggcgcggcggcggtgatgatgatgagc
gaagctaaagccgaggagctggggctgccgattctggcgcggatccgcgcttttgccagc
gtgggggtcgatccggcgctgatggggatcgcgccggtccatgccacccgtcgctgcctt
gaacgcgcgggctggaagctggatgaagtcgatcttatcgaagccaacgaagcctttgcc
gctcaggccatttcggtgggcagggtactggaatgggacgagcggcgggtgaacgtgaac
ggcggcgccattgcgctgggccacccgattggcgcttccggctgccgcattctggtttcc
ctggtgcacgagatgattaaacgcgatgcccgcaaagggctggccacgctatgcatcggc
ggcggccagggcgtggcgctggcggttgaacgcgaataa

DBGET integrated database retrieval system