KEGG   Klebsiella michiganensis HKOPL1: J415_11095Help
Entry
J415_11095        CDS       T03188                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:koy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    J415_11095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koy02000]
    J415_11095
Transporters [BR:koy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    J415_11095
   Histidine transporter
    J415_11095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: AHW87736
Position
2332814..2333500
Genome map
AA seq 228 aa AA seqDB search
MLYGFSQVIFQGALVTLELALSSVVLAVLIGLAGAGAKLSNNRPLALIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNGVTDALGLAQFDIDPMVAGIITLGFIYGAYFTETFRGAFLAVP
KGHIEAATAFGFSGGQTFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGLIYLVFTTVSNGVLLMLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacgggttttcacaggttatttttcagggcgcgctggtcacccttgagctggcg
ttaagctcggtcgttctggcggtgcttatcggtctggcgggcgccggggcgaaactttcc
aacaatcgtccgttggcgttgatttttgaaggctataccaccttaatccgcggcgtgccc
gatctggtgctgatgctgctgattttctacgggctacagattgcgctcaacggcgtaacc
gatgcgcttggcctggcgcagtttgatatcgaccccatggtggcggggatcatcacgctg
ggctttatttacggggcctacttcaccgaaacctttcgcggcgccttcctggcggtgcca
aagggacatattgaagcggcgacggccttcggctttagcggtgggcaaacctttcgtcgt
attctgtttccggcaatgatgcgctatgcgctgcccggaatcggcaacaactggcaggtt
atcctcaaagcgaccgcgctggtctcactgctgggactggaagatgtggtcaaggcaacc
cagctggcgggtaaaagcacctgggagccgttctactttgccatcgtctgtggcctgatt
tatctggtatttacaacggtttccaatggtgtgctgctgatgctcgaacgccgttattct
gtgggcgtgaagagggccgacctgtga

DBGET integrated database retrieval system