KEGG   Klebsiella michiganensis HKOPL1: J415_14190Help
Entry
J415_14190        CDS       T03188                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00460  Cyanoamino acid metabolism
koy00500  Starch and sucrose metabolism
koy01100  Metabolic pathways
koy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J415_14190
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    J415_14190
Enzymes [BR:koy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     J415_14190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like DUF11
Motif
Other DBs
NCBI-ProteinID: AHW88314
Position
2982463..2985243
Genome map
AA seq 926 aa AA seqDB search
MYDSQAGTPLEGFAEFAAAAAAEGAVLLRNDGQMLPLAPERPLSLFGRTQIDYYRSGTGS
GGAVNVVSSTTLLQAMRARNGMRLNTQLAGLYERWVEQHPFDNGGGGWAAEPWCQQEMPL
SDEQIRQARAFSSQAVIVFGRTAGEDRDNADVEGGYRLTADEMNLLYQVCGEFDDVAVVL
NTAGLIDLSWADDPRLRQRIRALLYVWHGGADGAQAATSLLYGEVTPSGKLVGSIAISLD
DHPASPCWGAEAQSLYQEDIYVGYRYFETFCPQRLQFPFGFGLSYTSFTLQSARAETFGD
LIKATVTVTNRGERFAGKEVVQIYLQAPQGALGKPAKALVAFAKTRLLRPGESETLTLSI
PLERFASLDDSGATGHPHCYVMEPGLYRLLLGNSVRDVQPLAVDGEAGYAQKTLRILSCH
QQVLAPTVPFVRIKPVADGDDGRYQIEWEDVPRREINLRARIEERLPEAITLTGNQGLTL
NDVAEGRTTMNAFVAQLSVEELACLVRGEGMCSHKVTPGVASAFGGVADSLLEKGIPLAS
TADGPSGIRMDNGAKATLLPSGTLLASSWDPILVERLYVMEGKELLRNGIDLLLGPGMNI
QRHPLNGRNFEYFSEDPLLTGMMAAAVVRGIRSGGGIATLKHFACNNQEFARAKADSVVS
ERALREIYLKGFEYAVKSGGANAVMTAYNPVNGHHAASNYDLTTTVLREEWGFRGIVMTD
WWATMNDPVDGGAASTHNTAAMIRAQNDLYMVVNNNGAEVNAGGDNTLAALATGELTLGE
LQRCAINILDFMMQTQVFKRGEMPRAGIIHLAADPACDGACPGAIKIAEQSRLRYDEELV
LSVERTAVYDVLVSVHANGAPLAQTACNLLLNEQFVATIQTNGTLGREIVQKLCRIELQS
GKYRVGFDFIKPGLVVDWLELKLVND
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacagtcaagcggggacgccgctggaagggtttgccgaatttgccgccgccgcc
gctgccgaaggcgcggtgctgttgagaaacgatggccaaatgttgccgctcgctcccgaa
cggccgctatcgttatttggccgaacgcagattgactactatcgcagcggtaccggttcc
ggtggggcggttaacgtggtgagcagcacaaccttgctgcaggcgatgcgtgcgcgaaac
gggatgaggctgaatacgcagctggccggactctacgaacgctgggttgaacaacacccc
ttcgacaacggcggagggggctgggcagcggaaccctggtgccagcaggagatgccgctg
agcgatgagcagattcgtcaggcgcgcgctttctccagccaggcagtgattgtttttggg
cgtaccgcgggagaggatcgggacaacgccgacgtggaaggtggctatcggctcaccgcc
gacgaaatgaacctgctgtatcaggtctgcggcgaatttgatgacgtggcggtggtgctg
aataccgccgggcttatcgatctctcatgggctgacgatccgcggctgcgtcaacgcatt
cgcgcgctgctctacgtctggcacggcggcgccgacggcgctcaggcggccacttcgctg
ctctatggtgaggtgacgccatccggcaagctggtaggcagcatcgcgatctctctcgac
gaccatccggcatcgccctgctggggggcggaagcgcaaagcctctatcaggaggatatt
tacgtcggctatcgctacttcgaaaccttttgtccgcagcgtctgcagttcccctttggc
tttggtctctcatacacctctttcaccctgcaatcggcgcgggcggagacttttggcgac
ctgatcaaggcgaccgtcaccgtgaccaatcgcggggagcgcttcgcgggcaaagaagtg
gtgcaaatctacctccaggcgccgcagggcgcgctcggcaaaccggccaaagcgctggtg
gcttttgccaaaactcgcctgctgcgacctggggaaagcgaaaccttaacgttatcaatt
ccgctggagcgctttgcttctctggacgatagcggagcgaccgggcatccacactgttac
gtgatggagccagggctttatcgtttgctgcttggtaacagcgtgcgcgatgtacagccg
ctggcggttgacggcgaggcggggtacgcgcagaaaacgctgcggatcctctcctgccat
cagcaggtgctggcgccgacggtgcctttcgtacgtataaaaccggtcgcggacggcgat
gatgggcgctatcagatcgagtgggaggacgtgccgcggcgggagattaatctgcgcgcg
cgcattgaggagcgtttgccagaggctatcacccttaccggtaaccagggactgaccctc
aacgacgtggctgaagggcgtaccacgatgaatgcctttgttgctcagctgtctgttgag
gagctggcctgcctggtgcgcggagaaggcatgtgtagccacaaagtgacgcccggcgtc
gcgtcggcttttggcggcgtggccgacagcctgctggaaaaaggtattcctctggcatcg
accgccgacggcccatccgggattcgcatggataacggcgcaaaggccactttgcttccc
agcggaacattattggcctccagctgggacccgatcctcgtggaacgcttatacgtgatg
gaaggcaaagagctgctgcgcaacggtatcgacctgctgttagggccggggatgaacatc
cagcgccatccgctgaacgggcgtaattttgagtacttttccgaagatccgctgctcacc
gggatgatggcggcggcggtggttcgcggcattcgcagcggcggcgggattgccaccctc
aagcactttgcctgcaacaatcaggagttcgccagagccaaagcggattcggtggtgtca
gagcgcgcgctgcgtgaaatctatctcaaaggttttgagtatgcggtgaaatccggcggc
gcaaatgcggtaatgaccgcttataacccggtcaacggccaccatgccgcatccaactac
gatctcaccaccaccgtcctgcgcgaggagtggggctttcgcgggatcgtgatgaccgac
tggtgggcaacgatgaacgatcccgtcgatggcggcgcggcgagcacccacaacaccgcg
gcgatgatccgcgcgcagaacgacctttatatggtggtcaataataacggcgcggaagtt
aatgcggggggagataataccctggcggcgctggcgacaggcgagctaacgctcggtgag
cttcagcgctgcgcgataaacatcctcgactttatgatgcagacgcaggtctttaagcgc
ggggagatgccgcgggcggggattattcacctggcggcggatcctgcgtgcgatggggcc
tgtcctggcgcaattaaaatcgccgagcagtcgcggctgcgctacgacgaggagctggtg
ctgagcgttgagcgaacagcggtatatgatgtgctggtgagcgttcacgctaacggtgcg
ccgctcgcacaaaccgcctgcaacctgctgcttaatgaacaatttgtggcgacgatccag
accaacggtacgctcggtcgtgagattgtgcagaagctgtgtcggattgagctacagtcg
gggaaatatcgtgtaggctttgattttatcaagccgggtctggtggtggactggctggaa
ctcaagctcgttaatgactaa

DBGET integrated database retrieval system