KEGG   Klebsiella michiganensis HKOPL1: J415_20175Help
Entry
J415_20175        CDS       T03188                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00520  Amino sugar and nucleotide sugar metabolism
koy01100  Metabolic pathways
koy01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    J415_20175
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    J415_20175
Enzymes [BR:koy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     J415_20175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AHW89462
Position
complement(4226495..4227517)
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGFELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIREASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHDDPDKALAIARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
RDPRAEAEIRARDMAIFRTLIGEQRLDAIMPAHVIYSDVDPRPASGSAHWLKTVLRGELG
FEGVIFSDDLSMEGAAIMGSYAERGQASLEAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFSRQALRDSARWKTISAQLEQLHARWQEAKSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccggtaatgttggatgtcgaaggttttgaactggatgcggaagagcgtgagatt
ctggcgcatcctttggttggcgggctgatcctgtttacccgcaactatcacgatccggcg
cagctgcgtgagctggtccgccagatccgcgaggcctcgcgcaaccatctggtggtggcg
gtagatcaggaaggcgggcgcgtacagcgtttccgcgagggctttacccgccttcccgcg
gcgcaatctttcgccgcgctgcttggcatggaggagggcggtaagctggccgcagaggcc
ggctggctcatggccagcgaaatgatcgccatggatattgatatcagctttgcgccggtt
ctggacgttgggcatatcagcgccgctattggcgagcgatcctatcacgacgatcccgac
aaagccctggcgatagctcgtcattttattgacggcatgcacgccgcgggaatgaaaacc
accggtaagcactttcccggacacggcgcggtgacggccgattcccataaagagacgccg
cgcgatccgcgcgcggaagcggaaattcgcgccagagatatggccatcttccgtacgctg
attggcgagcagcggcttgatgcgatcatgcccgctcacgtcatctacagcgacgttgac
ccgcgtccggccagcggatctgcgcactggctaaaaacggttctgcgcggtgagctggga
tttgaaggggtgattttctctgacgatctgtcgatggaaggggcggcgattatgggcagc
tacgccgagcgcggccaggcatcgctggaagcgggttgcgatatgatccttgtctgcaat
aatcgtaagggtgcggtcagcgtgctggataacctgtcgccgatcaaagcagaacgtgtt
acgaaattgtatcataaaggttcctttagccgtcaggcgttaagggattccgcccgctgg
aagacgatcagcgcgcagcttgagcagcttcacgcgcgctggcaagaggcgaaatccgcg
taa

DBGET integrated database retrieval system