KEGG   Klebsiella michiganensis HKOPL1: J415_23820Help
Entry
J415_23820        CDS       T03188                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00330  Arginine and proline metabolism
koy00360  Phenylalanine metabolism
koy00380  Tryptophan metabolism
koy00627  Aminobenzoate degradation
koy00643  Styrene degradation
koy01100  Metabolic pathways
koy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    J415_23820
   00360 Phenylalanine metabolism
    J415_23820
   00380 Tryptophan metabolism
    J415_23820
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    J415_23820
   00643 Styrene degradation
    J415_23820
Enzymes [BR:koy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     J415_23820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHW90151
Position
complement(4988847..4990031)
Genome map
AA seq 394 aa AA seqDB search
MQDDIRAFMPYPPHPVAHALSGPLSGLTFAVKDLFDVAGYPTGGGNPHLLALSGIKNRTA
PVVQKLLDNGARFIGKTHTSELAYSMSGHNVHYGTPRNGAAPNHIPGGSSSGSASAVSNA
ACDFALGSDTGGSVRTPASYCGLFGLRPTHGRLSLDGCQPLCATMDTCGFFARSPEVFSA
VAACLFDAERADFNGVRLACHDGLFSRLPLRSQQALLPVRQRLARFFGPLAPLDAPLPDA
DDIYLAFRQIQGYEAWQAQGETIERYGLQLGPDVRERFFWGKAVTRAQFDAACQLRERFT
AWWDAQLGDAVLVMPTVPDGAPLLTAQAEEIEAVRRLSHDLLLISVMTQRPQVTLPVAQT
GGLPLGMSFLGPRGSDRLLVELAAAFMQGDRNEQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgacattcgcgcctttatgccctatccgccgcatccggtggcgcatgcgctc
agcgggccgctgagcggcttaacctttgcggtcaaagatctgttcgacgtggcgggctac
cccaccggcgggggcaatccgcacctgctggcgctgtccgggattaaaaaccgcaccgcg
ccggtggtgcaaaagctgttagataacggcgcgcgctttatcggcaaaacccataccagc
gagctggcgtattcgatgagcgggcacaacgtgcattacggtaccccgcgcaacggcgcc
gcgccgaatcatatacccggcggatcgtcgtccggctcggcgtcggcggtatcgaacgcg
gcgtgcgactttgccctcggcagcgataccggcggctcggtacgcacgccggcgagctac
tgcggactgtttggcctgcgtccaacccacggccgtctctccctcgacggctgccagccg
ctgtgcgccaccatggacacctgcggcttctttgcccgctcgccggaggtcttttccgcc
gtcgccgcctgtctgttcgatgctgaacgcgcggatttcaacggcgtgcggctggcctgc
cacgatgggctgttttcccgcctgccgctgcgcagccagcaggcgctgctgccggtccgc
caacggctggcgcgctttttcggcccgttagcgccgctcgacgcgccgctgcccgacgcg
gacgatatttatctcgccttccgccagattcagggctacgaagcgtggcaggcgcagggc
gaaaccattgagcgctatggtctgcagctaggcccggacgtccgcgagcgctttttctgg
ggcaaagcggtcacccgcgcgcagtttgacgccgcctgccagctgcgcgagcgttttacc
gcctggtgggatgcgcagctgggcgatgcggtcctggtgatgccgaccgttcccgatggc
gcgccgctgctgacggcgcaggccgaagagatagaagcggtccggcgcctgtctcacgac
ctgctgttaatttccgtgatgacccaacgtccgcaggtgacgctgccggtcgcccagacg
ggcggtctgccgctggggatgtcatttttaggcccgcgcggcagcgatcgtctgcttgtc
gagctggccgccgcgtttatgcaaggagaccgaaatgagcagtga

DBGET integrated database retrieval system