KEGG   Klebsiella michiganensis HKOPL1: J415_27110Help
Entry
J415_27110        CDS       T03188                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00620  Pyruvate metabolism
koy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J415_27110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koy02000]
    J415_27110
Enzymes [BR:koy01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     J415_27110
Transporters [BR:koy02000]
 Other transporters
  Primary active transporters [TC:3]
   J415_27110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AHW90783
Position
5713536..5715305
Genome map
AA seq 589 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAALDDAGYWSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVQRFVERAVKNGMDVFRVFDAMND
PRNMQAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRYDVRLHLHAHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTKHDTGLDILKLESIAAYFREVRRKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQNAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYRTI
AKETAGILKGEYGHTPVPVNAALQARVLDGAEAITCRPADLLKPELAHLEADVKRQAQEK
NIQLADNAIDDVLTVALFPQVGLKFLENRHNPAAFEPVPQAEEVKPAVKAEKPAASGVYT
VEVEGKAFVVKVSDGGDISPLTAAAPVQATAPAAAPAGAGTPVTAPLAGTIWKVIAGEGQ
AVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVAVGDTLLSLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtcccttttcgccacc
cgcctgcgcctcgacgatatgctccccgttgcggccgccctcgatgacgcgggctactgg
tcccttgaatgctggggcggcgccacctttgacgcctgcatccgcttcctcggcgaggac
ccctgggtccgcctgcgcgagctcaaaaaggccatgccgaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgatgacgtggtgcagcgcttc
gtcgagcgcgccgtcaaaaacggcatggacgtgttccgcgtcttcgacgccatgaacgac
ccgcgcaatatgcaggccgccctgcaggcggtgcgcagccacggcgcccacgcccagggc
acgctctcctacaccaccagtccggcccacaccctgcagacctggctcgacctgaccgaa
cagctgctggagaccggcgtcgattccatcgcgattaaggacatgtccggcattctcacc
ccgatggcggccttcgagctggtgagcgaaatcaaaaagcgctatgacgtcaggctgcac
ctgcatgctcatgccaccaccgggatggcggagatggccctgctgaaggccatcgaggcc
ggcgtcgacggcgtcgataccgccatctcttccatgagcgccacctacggccacccggcc
accgaggcgctggtggcgacgctggcaggcacaaaacatgacaccgggctggatatcctg
aagcttgagagcatcgcggcgtacttccgcgaggtgcgcaggaaataccacgcctttgaa
ggccagctgaagggcaccgacagccgtatcctcgtggcccaggtgccgggcgggatgctc
accaacctcgaggggcagctgaagcagcagaacgccgcccaccgtctggatgaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtcactccgacttcg
cagattgtcggcacccaggcggtgcttaacgtgctgaccggcgaacgctacagaaccatc
gcgaaggagaccgccgggatactgaagggcgagtacggccacaccccggtgccggtgaac
gcggcattacaggcgcgcgtgctggacggagcagaggccatcacctgccgtccggcggac
ctgctgaagccggagctggcgcatctggaagccgacgtgaagcgccaggcgcaggagaag
aatattcagcttgccgacaacgccatcgacgacgtgctcaccgtggccctgttcccgcag
gtcggcctgaagttccttgagaaccgccacaacccggcggcctttgagccggtaccgcag
gctgaagaggtcaaaccggcggtgaaagcagagaaaccggccgcctccggcgtctacacc
gtggaagtggaaggcaaggcctttgtggtgaaggtcagcgacggcggcgatatcagcccg
ctgacggcagcggcccccgttcaggccacggcccccgcagccgccccggcaggtgccggc
accccggtgaccgcgccgctggcgggcaccatctggaaagtcatcgccggcgagggccag
gcggtggccgagggcgacgtgctgctgattctggaagccatgaagatggaaaccgaaatc
cgcgccgcgcaggccgggaccgtgcgcggtatcgcggtgaaatccggggacgcggtggcg
gtgggcgacaccctgctgagcctggcgtaa

DBGET integrated database retrieval system