KEGG   Klebsiella michiganensis HKOPL1: J415_27465Help
Entry
J415_27465        CDS       T03188                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00230  Purine metabolism
koy00240  Pyrimidine metabolism
koy00760  Nicotinate and nicotinamide metabolism
koy01100  Metabolic pathways
koy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    J415_27465
   00240 Pyrimidine metabolism
    J415_27465
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    J415_27465
Enzymes [BR:koy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     J415_27465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD NIR_SIR_ferr
Motif
Other DBs
NCBI-ProteinID: AHW90850
Position
complement(5793178..5793855)
Genome map
AA seq 225 aa AA seqDB search
MKWDWIFFDADETLFTFDSFSGLQRMFLDYSVTFSAEDFQDYQAVNKPLWVDYQNGAITS
LQLQHQRFDGWAERLNVPPGELNAAFMNAMAEICSPLPGAVSLLDSLQGKVKMGIITNGF
TSLQQTRLERTGLRDHFDLLIISEEVGVAKPDARIFDYALAQAGNPDRSRVLMVGDTAES
DIRGGVNAGLATCWFNPHQRELPADLRADWTVTSLSELEQLLCKH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggactggattttctttgatgccgacgaaacgttatttacgtttgactcattt
agcggcctacagcggatgtttctcgactatagcgtgacgttctccgcagaggattttcag
gactaccaggccgtgaataagccgctatgggtggattatcaaaacggcgccattacctct
cttcagctgcagcatcagcgctttgacggttgggcggaacgcctgaacgtccctcccggc
gagctgaacgccgcgtttatgaacgcgatggcggagatctgctcgccgctgccgggggcg
gtatcgctgcttgattcgctgcaggggaaggtaaaaatgggcatcatcaccaacggtttt
acctcactgcagcagacgcgtcttgaacgtaccggactgcgcgatcactttgatttgctc
attatttccgaagaggttggggtggctaagccggatgcgcgtattttcgactatgcgctg
gcgcaggcgggcaatcccgatcgttcgcgggtgctgatggttggcgatacggcggaatcg
gatattcgcggcggcgtgaatgccggcctggcgacctgctggttcaacccccatcagcgc
gaactgcccgcggacctccgcgcggactggacggtcacctctttaagcgaactggagcaa
ctcctgtgtaaacactga

DBGET integrated database retrieval system