KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_00983Help
Entry
KPNJ1_00983       CDS       T03176                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00052  Galactose metabolism
kpa00500  Starch and sucrose metabolism
kpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNJ1_00983
   00500 Starch and sucrose metabolism
    KPNJ1_00983
Enzymes [BR:kpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPNJ1_00983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AHM83389
UniProt: A0A0E1CDB1
Position
936929..938371
Genome map
AA seq 480 aa AA seqDB search
MKMMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHP
YSTQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKF
HGDPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAR
EGDTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAG
FSNRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWE
SPLPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVD
NCEAMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLT
AGADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccag
gcgcttaatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaac
gacccaaacggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccg
tactccacccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcac
tgggagcatttgccggtagccctggcgccggagggcccggaggataaagacggctgcttt
tccggctcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttc
cacggcgatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgc
gacgggatccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccac
ttccgtgacccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgc
gaaggcgataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggac
gcgggggtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttc
ttcaccctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcgggg
ttcagcaaccgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccag
cgttttattcgccatggcgaattccgggagatggataacggccacgatttctatgccccg
caaagcttctccacccccgatggccggcggatcgtgattggctggctggatatgtgggaa
tcgccgctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctg
agcctgagcgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgc
ggcgcctggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgac
aactgcgaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcag
tatggtctgcgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctg
gtgctggaacggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgacc
gccggggcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtc
aatgacggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaatta
gcgttatttgcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaa
taa

DBGET integrated database retrieval system