KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_01644Help
Entry
KPNJ1_01644       CDS       T03176                                 

Definition
(GenBank) Histidine transport ATP-binding protein hisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KPNJ1_01644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpa02000]
    KPNJ1_01644
Enzymes [BR:kpa01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     KPNJ1_01644
Transporters [BR:kpa02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    KPNJ1_01644
   Histidine transporter
    KPNJ1_01644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 ABC_ATPase AAA_13 AAA_16 AAA_33 AAA_23 G-alpha PRK RsgA_GTPase AAA_24 NACHT AAA_22 DUF87
Motif
Other DBs
NCBI-ProteinID: AHM84050
UniProt: A0A0E1CB55
Position
1574128..1574901
Genome map
AA seq 257 aa AA seqDB search
MSDNKLNVIDLHKRYGEHEVLKGVSLQAKAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TIVVSGQNIGLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDERQQAKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGHPDALF
GAPKSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaataaattaaacgttatcgatctgcataaacgctatggggaacacgaggtg
ctgaagggcgtctcgctgcaggcgaaagccggggacgttatcagcatcatcggttcatcg
ggctccggaaaaagtacctttttgcgctgtattaacttccttgaaaaaccgagcgaaggc
acgatcgtcgtcagcggccaaaatattggtctggtacgggataaagacggccagctgaag
gtggccgacaagaaccagttgcgcctgctgcgcacccggttgaccatggtgtttcagcat
ttcaatctgtggagccatatgacggtgctggagaacgtcatggaagcaccgattcaggtg
ctgggcttaagcaaacaggaagcgcgcgaacgggcggtaaaatatctggccaaggtcggg
atagacgaacgtcagcaggcgaagtatccggtgcatctttccggtggccagcagcagcgt
gtctctattgcccgcgcgctggcgatggaaccggaagtgctgctgtttgatgagccgacc
tccgcgctggatccggaactggtgggcgaagtgttacgcattatgcagcagctggcggaa
gagggaaaaaccatggtggtggtgacccatgaaatgggctttgcccgccacgtctcttca
catgtcatttttctgcatcagggtaaaattgaagaagaagggcatccggatgcgctgttt
ggcgcgccgaaaagcccgcgcctgcagcagtttctgaaaggttcgctgaaataa

DBGET integrated database retrieval system