KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_02415Help
Entry
KPNJ1_02415       CDS       T03176                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00280  Valine, leucine and isoleucine degradation
kpa00310  Lysine degradation
kpa00362  Benzoate degradation
kpa00380  Tryptophan metabolism
kpa00620  Pyruvate metabolism
kpa00630  Glyoxylate and dicarboxylate metabolism
kpa00640  Propanoate metabolism
kpa00650  Butanoate metabolism
kpa00900  Terpenoid backbone biosynthesis
kpa01100  Metabolic pathways
kpa01110  Biosynthesis of secondary metabolites
kpa01120  Microbial metabolism in diverse environments
kpa01130  Biosynthesis of antibiotics
kpa01200  Carbon metabolism
kpa01212  Fatty acid metabolism
kpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNJ1_02415
   00630 Glyoxylate and dicarboxylate metabolism
    KPNJ1_02415
   00640 Propanoate metabolism
    KPNJ1_02415
   00650 Butanoate metabolism
    KPNJ1_02415
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNJ1_02415
   00072 Synthesis and degradation of ketone bodies
    KPNJ1_02415
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNJ1_02415
   00310 Lysine degradation
    KPNJ1_02415
   00380 Tryptophan metabolism
    KPNJ1_02415
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNJ1_02415
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNJ1_02415
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNJ1_02415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpa04147]
    KPNJ1_02415
Enzymes [BR:kpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNJ1_02415
Exosome [BR:kpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNJ1_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHM84821
UniProt: A0A0E1CDT5
Position
complement(2326016..2327197)
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPVGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgccgtacgcaccccggtaggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcagcggtggtgcgcggcctgcttgaacgc
tgccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgcttaccgccggc
tgcgggcaaaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccggactgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcggcggccgctatcgccgccgggcgctttcgtgaggagatcgtt
ccggtcagcgtcccgcagggcaaaaagccgccgcgagtcgtgactgacgatgagcaaccg
cgcccggagaccagcgagcagcagctggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcctcgtcgctgaacgacggcgccgcggcggtcctgctg
atgcgcgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccatcggtgatgggcattggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggtcagctgcttgagtgggatagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggcaaccctgtgc
gtcggcggcggccagggcatcgccatgaccctacaacgttaa

DBGET integrated database retrieval system