KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_03331Help
Entry
KPNJ1_03331       CDS       T03176                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00480  Glutathione metabolism
kpa00590  Arachidonic acid metabolism
kpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    KPNJ1_03331
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPNJ1_03331
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KPNJ1_03331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AHM85737
UniProt: A0A0E1CFS6
Position
3161368..3161880
Genome map
AA seq 170 aa AA seqDB search
MNCFYSQEPAMTPFYQLTATRLRGQPLSMADYAGKVVLVVNTASHCGFTPQYAGLEALYK
KYAAQGLVVLGFPCNQFGKQEPGGADEIEQTCHVNYGVSFPMFEKVDVNGPAAHPLFRYL
KQALPGVLGGRIKWNFTKFLIGRDGTPLTRFAPFTTPEKMEASIVAALTR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgaactgtttctactctcaggagcctgctatgacccctttttatcaattgacggctacc
cgcctgcgcggccagcccctctccatggctgactatgctggcaaggtggttctggtggtg
aatacggccagccattgtggcttcacaccgcaatacgctggcctggaagcgctctacaaa
aagtacgcggctcaggggctggtagtgcttggtttcccgtgcaaccagtttggtaagcag
gaacccggcggtgcggatgaaatcgagcagacttgtcacgttaactacggcgtgagcttc
ccgatgtttgagaaagtggacgtcaacggccccgccgcacacccgctgtttcgttatctg
aaacaagcgttgcccggcgtgctcggcggacggatcaagtggaatttcaccaagttcctc
atcggtcgcgacggcacacccctcacgcgttttgcgccgttcacgacgccggagaaaatg
gaagcctccattgtcgcggccctcacgcgctga

DBGET integrated database retrieval system