KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_03501Help
Entry
KPNJ1_03501       CDS       T03176                                 

Definition
(GenBank) Glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00010  Glycolysis / Gluconeogenesis
kpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNJ1_03501
Enzymes [BR:kpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     KPNJ1_03501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AHM85907
UniProt: A0A0E1CG78
Position
complement(3312725..3313990)
Genome map
AA seq 421 aa AA seqDB search
MTKDEGMKKRLLAAAVAGAVMLSAGAQAQDTAAPEGYQLQQVLIMSRHNLRAPLANNGSV
LEQSTAKAWPQWDVPGGQLTTKGGVLEVYMGHYMREWLAQQKLVTSGECPPENAVYAYTN
SLQRTVATAQFFITGAFPGCGIPVHHQPQMGTMDPTFNPVITDDSPAFREKALQAMEKER
QGMQLTESYKLLETMIDYRNSPSCKEKKVCSLSEGKDTFSAGYQQEPGVSGPLKVGNSLV
DAFTLQYYEGFPKDQVAWGEIASDKQWQVLSKLKNGYQDSLFTSVAVAQNVAKPLVKYID
NALVGEGASKAKVTLLVGHDSNIASLLTALDFKPYQLPGQYERTPIGGKLLFQRWHDSAG
NRDLMKIEYVYQSTEQLRNADALTLQAPPQRITLALNGCPVDDQGFCPLETFKKVINEAA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggatgaagggatgaaaaaacgtctacttgccgccgccgttgccggcgcggtg
atgttatccgctggcgctcaggcgcaggacacggccgccccggaggggtatcagctgcag
caggtgctgatcatgagtcgtcacaacctgcgtgcgccgttggccaataacggcagcgtg
ctggagcagtccaccgccaaggcctggccgcagtgggatgtgccgggcggccagctgacc
accaaaggcggtgtgctggaggtgtatatgggccactatatgcgcgaatggctggcgcag
cagaagctggtgaccagcggcgagtgcccgccggaaaacgcggtttatgcctacactaac
agcctgcagcgcaccgtcgccaccgcgcagttctttatcaccggcgcgttcccgggctgc
ggcatcccggtgcatcaccagcctcagatgggcaccatggacccgaccttcaacccggtt
attaccgacgactccccggcgtttcgcgagaaagcgctgcaggcgatggaaaaagagcgc
cagggaatgcagttgaccgagagctacaagctgctggagacgatgatcgattaccgcaac
tcaccctcctgcaaagagaagaaggtctgttccctgagcgagggtaaagatacctttagc
gccggttatcagcaggagccgggagtgtccggaccgttgaaggtgggcaactcgctggta
gacgccttcaccctgcaatattatgaaggcttcccgaaagatcaggtggcgtggggggag
atcgccagcgataagcagtggcaagtgctgtcgaagctgaaaaatggctatcaggatagt
ctgtttacctcggtggcggtggcgcaaaacgtcgccaaaccgctggttaaatatatcgat
aacgcgctggtgggcgagggagccagcaaggcgaaagtcacgctgctggtgggacacgac
tcgaatatcgcttcgctgctcaccgccctggactttaagccctatcaactgcccggccag
tatgagcgcactcctatcggcggcaaactgctgtttcagcgctggcatgacagcgccggc
aatcgcgatctgatgaagattgagtatgtctatcaaagtaccgagcaactgcgtaacgcc
gacgcgttaaccctgcaggccccgccgcagcggatcactctggcgcttaacggctgtccg
gttgatgaccagggattctgcccgctggagacctttaaaaaggtgatcaacgaggcggcg
aaataa

DBGET integrated database retrieval system