KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_05428Help
Entry
KPNJ1_05428       CDS       T03176                                 

Definition
(GenBank) Oxygen-independent coproporphyrinogen-III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00860  Porphyrin and chlorophyll metabolism
kpa01100  Metabolic pathways
kpa01110  Biosynthesis of secondary metabolites
Module
kpa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPNJ1_05428
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     KPNJ1_05428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHM87816
UniProt: A0A0E1CM75
Position
complement(5196764..5198221)
Genome map
AA seq 485 aa AA seqDB search
MAAQPAHDPRCGGAGTAYPSAAPSEGVSMSEQIIDWDLALIQKYNYSGPRYTSYPTALEF
SPQFGAAEFDAAVARYPQRPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDVLEQE
IIHRAPLFATRQVKQLHWGGGTPTYLNKAQISRLMDLLRSHFHFSAEAEISIEVDPREIE
LDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEAFIFDLLNHAREIGFTSTNIDLIY
GLPKQTPESFAFTLQKVAELNPDRLSVFNYAHLPTLFAAQRKIKDADLPSAEQKLEILQE
TIGSLTTAGYQFIGMDHFARPDDELAVAQRHGVLHRNFQGYTTQGDTDLLGMGVSAISMI
GDSYAQNQKELKQYYQQVAEQGNALWRGIALTRDDCLRRDVIKALICNFQLDIAAVEAQW
DVDFASYFAEDLKLLAPLAHDGLVAVDDKVIQVTAKGRLLIRNICMCFDAYLRQKARMQQ
FSRVI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcaaccggctcatgacccgcggtgcggtggggccgggacggcgtacccgtcg
gcggcaccatcggaaggagtgagcatgtctgagcagataatcgactgggatctggccctg
atccagaaatataactattccgggccgcgctatacctcgtatcccaccgcgctggagttt
tcaccgcaatttggcgcggcggaattcgatgccgctgtggcccgttacccacagcgtccc
ctgtcgctgtacgtgcatatcccgttttgccataagctgtgttatttctgcggctgcaat
aagatagtcacccgccagcagcataaggccgatcaatatctcgatgtccttgaacaggag
atcatccaccgcgcgccgctgtttgccactcgccaggtgaagcaactgcactgggggggc
ggcacgccaacttatctcaataaggcgcaaatcagtcgcctgatggatctgttgcgcagc
catttccatttcagcgcggaagccgagatctccatagaggtcgatccgcgtgagatcgaa
ctggatgtcctcgatcatttacgcgctgagggtttcaaccgcctgagtatgggcgtacag
gacttcaataaagaggttcagcgtctggttaaccgtgagcaggacgaagcgttcatcttt
gatttgctcaaccatgcgcgggagattggttttacctcgaccaatatcgacctcatttat
ggcctgccgaagcaaacgccggagagcttcgcctttaccctgcaaaaggtcgccgagctc
aatcctgaccgcctgagcgtgtttaactatgcgcatctgcccacgctctttgccgctcag
cggaagattaaagatgccgatctgccctccgctgagcagaagctggagatcctgcaggaa
accatcggctcgctgacgacggcaggctatcagtttatcggcatggaccatttcgcccgt
cccgatgatgaattagcggtcgcgcaacgtcacggcgtactgcatcgtaatttccagggc
tacaccactcagggcgataccgatctgctggggatgggcgtttcggcgatcagcatgatt
ggcgacagctacgcccagaaccaaaaagagctcaagcagtactaccagcaggtagcagag
caagggaacgccctgtggcgcgggatcgcgttaactcgcgatgattgtctgcgtcgcgac
gtgattaaagcgttgatctgtaacttccagctggatatcgcggcggtcgaggcgcagtgg
gatgtggattttgcgtcttatttcgccgaggatctgaagctgctggcgccgctggcgcat
gacgggctggtggctgtggatgataaggtcattcaggtgacggcgaaaggccgcctgctg
atccgcaacatctgtatgtgctttgatgcctacctacggcaaaaggcccggatgcagcag
ttctcacgggttatttaa

DBGET integrated database retrieval system