KEGG   Klebsiella pneumoniae blaNDM-1: FH42_04475Help
Entry
FH42_04475        CDS       T03440                                 

Definition
(GenBank) calcium-binding protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00053  Ascorbate and aldarate metabolism
kpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    FH42_04475
Enzymes [BR:kpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     FH42_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: AIJ39982
UniProt: A0A080T0X4
Position
complement(890277..891155)
Genome map
AA seq 292 aa AA seqDB search
MRIEVLLDLKTRLGESPVWDVEQQRLWWVDSLDGRLFACNAQGGAIKSWDVRQKIGSFAL
RQNGEGAVVALQNGVHLLDFASGELTLLHHPEADRPFNRLNDGKVDRQGRFLFGSMDMRE
EEPSGALYRLDPDLSLHVLKKDIIVSNAPCWSPSGETFYFADTWTGEICAWDYNTATGDL
SGERVFCHVDRSEGGAADGATVDSEGYLWNALVYAGKLVRYTPEGKVDRIIEMPVKKVTS
VMFGGENLDVLYVTSMAQPPLPRFPEDNQLRGSLFAIYDLGVTGVAERRFAG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgaagtgttactggatttaaaaacccgactcggcgaaagcccggtctgggat
gtcgaacagcagcgtctttggtgggtggacagcctcgacgggcgcctgttcgcctgcaac
gcgcagggcggcgcgatcaagagctgggacgtgcgacagaaaattggctctttcgccctg
cgccagaacggcgaaggcgcggtggtggcgctgcagaatggcgttcatctgctcgacttc
gccagcggcgagctgacgctgttgcaccatccggaagcggaccgaccctttaaccggctc
aacgacggcaaagtcgatcgtcagggacgctttctgttcgggtcaatggatatgcgcgaa
gaggaaccgagcggcgcgctatatcgcctggaccccgatctgtccctgcacgtgctgaag
aaagacattatcgtctctaacgccccctgctggagcccctccggcgagaccttctatttt
gccgatacctggacgggcgaaatctgcgcctgggactacaacaccgcgaccggcgatctt
tccggcgaacgggtcttttgccatgtcgatcgcagcgaaggcggcgcggcggacggcgcc
accgtggacagcgaaggctatctgtggaacgcgctggtctacgcgggcaagctggtgcgc
tataccccggagggcaaggtcgatcgcatcattgagatgccggtgaaaaaagtgaccagc
gtgatgttcggcggcgaaaaccttgatgtgctgtacgtcacctccatggcgcagccgccc
ctgccgcgcttcccggaagataatcagctgcgcggcagcctgttcgccatttacgacctg
ggcgtgaccggcgtagcggaacggcgcttcgccggctaa

DBGET integrated database retrieval system