KEGG   Klebsiella pneumoniae blaNDM-1: FH42_06680Help
Entry
FH42_06680        CDS       T03440                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00360  Phenylalanine metabolism
kpb00362  Benzoate degradation
kpb00621  Dioxin degradation
kpb00622  Xylene degradation
kpb01100  Metabolic pathways
kpb01120  Microbial metabolism in diverse environments
kpb01220  Degradation of aromatic compounds
Module
kpb_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    FH42_06680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FH42_06680
   00622 Xylene degradation
    FH42_06680
   00621 Dioxin degradation
    FH42_06680
Enzymes [BR:kpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     FH42_06680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm SOUL
Motif
Other DBs
NCBI-ProteinID: AIJ40398
UniProt: A0A5P3HX04
Position
complement(1334635..1335651)
Genome map
AA seq 338 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLAQVQQIASALDKAGVDSIEVAHGDGLQGSSFNYG
FGAHSDIAWIEATADVVSQAKIATLLLPGIGTLHDLKAAYQAGARVVRVATHCSEADVAA
QHIAFARELGMDTVGFLMMSHMISPQALAQQALKMESYGATCIYVVDSGGAMNMNDIRDR
FRALKAVLKPETATGMHAHHNLSLGVANSIVAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWQHGTDLYALMNAADELVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEAAAK
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLLNRNK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactttatatctcggacgtgacgctgcgcgatggtatgcacgccatt
cgtcaccagtattccctggcgcaggtgcagcagatcgccagcgcgctggataaggctggg
gtcgactccatcgaagtggcccatggcgatggcctgcagggatccagcttcaactatggc
tttggcgcccacagcgacatcgcctggattgaagcgacagcggatgtcgtgagccaggcg
aaaatcgccaccttgctgctgccgggcatcggcacgctgcacgatctgaaagcagcctat
caggccggggcgcgggtggtgcgggtcgccacccactgcagcgaagcggacgtcgccgcg
cagcatattgcctttgcccgcgagctggggatggacaccgtcggttttctgatgatgagc
catatgatctccccgcaggcgctggcgcagcaggcgctgaagatggaatcttatggcgcg
acctgtatctatgtggtggattccggcggggcgatgaacatgaacgacattcgcgaccgc
ttccgcgccctgaaggcggtgctgaagccggagaccgccaccgggatgcatgcccatcat
aatctgagcctcggggtggcgaactcgatcgtcgcggtggaagaggggtgcgatcgcatt
gacgccagcctggccgggatgggggcgggggcgggcaatgcgccgctggaggtgtttatt
gccgccgccgacaagctcggctggcagcatggcaccgatctctacgccctgatgaacgcg
gccgatgagctggtgcggccgctgcaggatcgcccggtgcgtgtcgaccgcgaaacgctg
gcgctgggctacgccggagtctactccagcttcctgcgccacagcgaagcggcggccaag
cgctatggcctcagcgcggtggatattctcgtcgagctgggcaagcggcggatggtcggc
ggccaggaggatatgatcgtcgacgtcgcgctggatctgcttaaccgcaataaataa

DBGET integrated database retrieval system