KEGG   Klebsiella pneumoniae blaNDM-1: FH42_07500Help
Entry
FH42_07500        CDS       T03440                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00010  Glycolysis / Gluconeogenesis
kpb00020  Citrate cycle (TCA cycle)
kpb00620  Pyruvate metabolism
kpb01100  Metabolic pathways
kpb01110  Biosynthesis of secondary metabolites
kpb01120  Microbial metabolism in diverse environments
kpb01130  Biosynthesis of antibiotics
kpb01200  Carbon metabolism
Module
kpb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FH42_07500
   00020 Citrate cycle (TCA cycle)
    FH42_07500
   00620 Pyruvate metabolism
    FH42_07500
Enzymes [BR:kpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     FH42_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AIJ40550
UniProt: A0A483VPZ9
Position
complement(1507743..1509386)
Genome map
AA seq 547 aa AA seqDB search
MSQQIESVKMALQELGINASGEFYYNPDYDLLIAHETSPELTGAARGVMTDSGAVAVDTG
IFTGRSPRDKYIVRDEQTRDTVWWADSGLGRNDNKPLSPDVWRSLKSLVAGQLSGKKLYV
IDAWCGASPDTRLGVRFVTEVAWQAHFVKNMFIVPSADELASFTPDFVVLNGAGCTNANW
QAQGMNSENFVAFNLSERIQLIGGTWYGGEMKKGLFSVMNYLLPQKGIASMHCSANRGEA
GDVALFFGLSGTGKTTLSTDPHRQLIGDDEHGWDDDGVFNFEGGCYAKTINLDPQAEPEI
YGAIRRNALLENVVVRADGSVDYADGSKTENTRVSYPLSHIDNIVKPVSRAGHPSKVIFL
AADAFGVLPPVSRLTTEQMQYHFLSGFTSKLAGTERGITQPTPTFSACYGAAFLLLHPTQ
YASVLAAKMAESGAEAWLVNTGWNGEGKRLSLRDTRSIISAILNGTTGPLREETIPVFGL
AIPQSIPGVDSAVLDPRNGWSSADKWQEKAESLAQLFMDNFKQYSDTEAGARLALAGPQL
QKSAVEV
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaaattgaatcagtaaaaatggctctgcaggagctggggattaatgcaagc
ggcgaattctattacaaccctgattacgatttgcttattgcacatgaaacctctcctgag
ctgaccggcgcggcccgcggcgtgatgaccgactctggcgctgtggctgttgataccggg
atcttcaccggccgttcgccgcgcgataaatacatcgtccgcgacgaacagactcgcgac
accgtctggtgggcagactccggcctcggccgcaacgacaacaaaccgttatcgccagac
gtgtggcgcagcctgaaaagcctggtcgcgggccagctgagcggcaaaaaactgtacgtc
atcgacgcctggtgcggcgccagcccggacacccgtcttggcgtacgcttcgtcaccgag
gtggcgtggcaggcccactttgtcaaaaacatgttcatcgtgccaagcgccgacgagctg
gccagctttacgccagacttcgtggtgctcaacggcgcgggctgcaccaatgccaactgg
caggcgcaggggatgaactccgagaactttgtcgcctttaatctgagcgagcgtattcag
ctcatcggcggtacctggtacggcggcgaaatgaagaaagggctgttctcggtcatgaac
tacctgctgccgcagaaaggcatcgcgtcgatgcactgctcggccaaccgtggcgaagca
ggggacgtggcgctgttcttcggcctctccgggaccgggaaaaccaccctgtcgaccgat
ccgcatcgtcagctgatcggcgatgatgagcacggttgggacgatgacggcgtgtttaac
ttcgaaggcggctgctacgccaagaccatcaatctcgatccgcaggcggagccggagatt
tatggcgccatccgccgcaatgcgctgctggaaaacgtggtggtgcgcgctgacggcagc
gtggattatgccgacggcagcaaaaccgaaaacacccgcgtctcctatccgctgtcgcat
atcgacaatatcgtcaagccggtgtcccgcgcgggccatccgtcgaaggtgattttcctt
gccgccgatgcgtttggcgttctgccgccggtctcccgtctgaccaccgagcagatgcag
taccatttcctgtcgggtttcacctcgaagctggcgggcaccgagcgcggcattacccag
ccgacgccgaccttctccgcctgctatggcgcggcgttcctgctgcttcacccgacccag
tacgccagcgtcctggcggcgaagatggcggaatccggtgccgaagcctggctggtcaac
accggctggaacggcgaaggcaaacgcctgtcgctgcgcgatacccgcagcatcattagc
gcgatcctcaacggcactaccggcccgctgcgcgaggagaccatcccggtgttcggtctt
gcgatcccgcagagcattccaggggtagacagcgcggtgctggatccgcgtaatggctgg
agttcagcggataaatggcaggagaaggccgagagcctggctcagctgtttatggataac
ttcaagcagtacagcgataccgaagcgggcgcgcgtctggcgctggccggtccgcagctg
cagaagagcgcggtcgaagtctga

DBGET integrated database retrieval system