KEGG   Klebsiella pneumoniae blaNDM-1: FH42_12310Help
Entry
FH42_12310        CDS       T03440                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00071  Fatty acid degradation
kpb00072  Synthesis and degradation of ketone bodies
kpb00280  Valine, leucine and isoleucine degradation
kpb00310  Lysine degradation
kpb00362  Benzoate degradation
kpb00380  Tryptophan metabolism
kpb00620  Pyruvate metabolism
kpb00630  Glyoxylate and dicarboxylate metabolism
kpb00640  Propanoate metabolism
kpb00650  Butanoate metabolism
kpb00900  Terpenoid backbone biosynthesis
kpb01100  Metabolic pathways
kpb01110  Biosynthesis of secondary metabolites
kpb01120  Microbial metabolism in diverse environments
kpb01130  Biosynthesis of antibiotics
kpb01200  Carbon metabolism
kpb01212  Fatty acid metabolism
kpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FH42_12310
   00630 Glyoxylate and dicarboxylate metabolism
    FH42_12310
   00640 Propanoate metabolism
    FH42_12310
   00650 Butanoate metabolism
    FH42_12310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FH42_12310
   00072 Synthesis and degradation of ketone bodies
    FH42_12310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FH42_12310
   00310 Lysine degradation
    FH42_12310
   00380 Tryptophan metabolism
    FH42_12310
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FH42_12310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FH42_12310
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FH42_12310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpb04147]
    FH42_12310
Enzymes [BR:kpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FH42_12310
Exosome [BR:kpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FH42_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIJ41470
UniProt: W9BN63
Position
complement(2545193..2546371)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVVKALVEKTGIDPHSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREFGISRELQDAWAL
SSQHKARKAIDSGRFRDEIVPVVTEHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDDVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtcgtgatcgtcggcgcgctgcgaacgccgattggctgctttcagggcgca
ttatcgcgccattcagccgtcgagctggggagcgtggtggtgaaggcgctggtggagaaa
acgggaatcgatccgcacagcgtggatgaggtgatcctcggccaggtgctgaccgcgggg
accggacaaaatccggcgcgtcagtccgctattcgcggtgggctgcctaacaccgtatcg
gctatcaccattaacgatgtctgcggttccggcctgaaggctctgcacctcgctacccag
gcgatccagtgcggggaagcggacgtggtgatcgctggcggccaggagaatatgagccgc
gctccgcatgtgcttaccgacagccgcaccggcgcccagctgggcaacagccagctgatt
gacagtctggtgcatgatgggctgtgggatgctttcaacgattatcatatgggcgtcacg
gcggaaaacctggcccgggaatttggcatcagtcgcgagctgcaggacgcctgggcgctc
agctcacagcataaggcgcgcaaggcgattgattccggtcgctttcgcgatgagatcgtc
ccggttgtcaccgagcataacggcgcggcgcgcaccgtggataccgatgaacaaccgcgg
gtggatgccagcgcggaagggctggccagcctgcagcccaccttcgatcgccttggatcg
gtaaccgccggcaacgcctcaagcatcaatgacggcgcggcggcggtaatgatgatgagc
gaggctaaagcgctggagctggggctgccgatccttgcgcggatccgcgccttcgccagc
gtcggcgtcgatccggcgctgatgggcattgccccggtgcatgccacccgtcgctgtctg
gagcgggccggctggcggctggacgacgtcgatctgatcgaagccaatgaggcctttgcc
gctcaggcgatctcggttggccgggtactggagtgggatgagcgccgggtcaacgtcaac
ggcggcgcgatcgccctcggccaccccatcggcgcctccggctgccggattctggtgtcg
ctggtgcatgaaatgatcaagcgcgatgcccgcaaaggtctggcgacgctgtgcattggc
ggcggtcagggcgtggcgctggcggtagaacgcgcatag

DBGET integrated database retrieval system