KEGG   Klebsiella pneumoniae blaNDM-1: FH42_22205Help
Entry
FH42_22205        CDS       T03440                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00010  Glycolysis / Gluconeogenesis
kpb00020  Citrate cycle (TCA cycle)
kpb00620  Pyruvate metabolism
kpb01100  Metabolic pathways
kpb01110  Biosynthesis of secondary metabolites
kpb01120  Microbial metabolism in diverse environments
kpb01130  Biosynthesis of antibiotics
kpb01200  Carbon metabolism
Module
kpb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FH42_22205
   00020 Citrate cycle (TCA cycle)
    FH42_22205
   00620 Pyruvate metabolism
    FH42_22205
Enzymes [BR:kpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FH42_22205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl SLD3
Motif
Other DBs
NCBI-ProteinID: AIJ43341
UniProt: A0A2V1L9V6
Position
complement(4593867..4595402)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
ILAREGETLQVGAVLALAADASVSDAELDEFVARLATAKPAAPGPEAAAPDVAAQAGAKP
ASVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLESAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAAALLLDEHPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLALRQDINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatatgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggccccctttgccggtacgttacgtcgg
atactcgcccgcgagggtgagacgcttcaggtaggcgccgtgctggccctggcggctgac
gcgtcggtcagcgatgctgaactggacgaatttgttgcccgcctggcgacggcgaaaccc
gcagccccaggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
gcttccgttgtttcgccgccatccaacagccccgagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggtgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgccccccgttcgtcgcagcaaagcgccccgctcgcatgccgatgacagccaggta
tcggccaccccgctggcgcgccgcctggccggcaaactgggtatcaacttgcatgactgc
cgaagcagcggttcacgcggtcgggtaagtcgcgatgatgtgctggccgcggcgttgtta
ctcgacgagcacccgcagaccagtcctgtgcaggagagtgccccggccccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcctgcaaacgtccaagcaacag
tctccccatttccgtttgagcgtcgatctcgatctggagcgactgttagcgttacgtcag
gacattaaccgcgaagtacccggcgtcaagatttcggtgaatgacctgctggtgaaggcc
tgcgccctggcgctggtggccgtgcctgacgtcaatatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgattagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgacagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system