KEGG   Klebsiella pneumoniae blaNDM-1: FH42_23520Help
Entry
FH42_23520        CDS       T03440                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00052  Galactose metabolism
kpb00500  Starch and sucrose metabolism
kpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FH42_23520
   00500 Starch and sucrose metabolism
    FH42_23520
Enzymes [BR:kpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FH42_23520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIJ43590
UniProt: W9BE89
Position
complement(4861458..4862858)
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYAPQTMQADDGRRLLVGWMGV
PDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELVALRGEAQGWCGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgtctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcaacggactgctgaac
gatcctaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgcgaccatacctataagtgctggggacactggagctctgccgatctgctgcac
tggcggcacgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tctggcagcgcggtcgagttcgagggtgccctgactctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgcaccgcctggcaatgtctggcgaccgagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctgccagaaggctataccggccatgtgcgcgac
cctaaagtgtggcggcaggacgggcgctggtacatggttcttggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggagtggcgcctggtgggc
gagatcgccgggcacgacgtgaacggcctggcgaacgccggctacatgtgggagtgcccg
gatctctttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacgcgggatcttcgaccacggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgcaggccgacgatggccgccgcctgctggtcggctggatgggcgtc
cccgacggggacgagatgcatcagcccacccgcgcgcagggctggatccatcagatgacc
tgcgtgcgtgagctggagtggcaggctggcactctgtatcagcgtccgctgcgcgagctg
gtcgccctgcgcggggaagcccagggctggtgcggacagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagcacgctggggctggactttgccggcgccctg
cagctcaccgtcaatcgcgacggtctgcgtctgtcgcgccgcggcctgcagacggcggag
atgcatcaccgctactggcgcggcgaggcgcgccgcctgcggatctttatcgaccgctcc
agcgtagagattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system