KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_01305Help
Entry
KPNIH10_01305     CDS       T03788                                 

Definition
(GenBank) PTS friuctose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00051  Fructose and mannose metabolism
kpc01100  Metabolic pathways
kpc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPNIH10_01305
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KPNIH10_01305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpc02000]
    KPNIH10_01305
Enzymes [BR:kpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     KPNIH10_01305
Transporters [BR:kpc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    KPNIH10_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AIA34602
Structure
PDB: 

Position
complement(279961..280455)
Genome map
AA seq 164 aa AA seqDB search
MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNVV
SLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAV
SLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaccctcgcccgtattgatgaccgactgattcatggccaggtcaccaccgtg
tggtcaaaagtcgccaacgcccagcggataattatctgcaatgacgatgtatttaacgat
gaggttcgccggaccctgttgcgccaggcggctccgccaggcatgaaggtaaacgttgtc
agtctggaaaaagcggttgcggtctatcataacccgcaatatcaggacgagaccgtcttt
tatttatttaccaatccacacgatgttttaacgatggtgcgccagggcgtgcagatcgcc
acgttaaatattggtggcatggcctggcgacccggtaaaaaacagctaaccaaagccgtt
tctttggatccgcaggatattcaggcattccgtgaactcgataaactgggcgtaaaactc
gatttacgcgtggtcgcatcagatccgtcagtcaatattctcgacaaaattaacgaaaca
gctttctgcgaataa

DBGET integrated database retrieval system