KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_06925Help
Entry
KPNIH10_06925     CDS       T03788                                 

Definition
(GenBank) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00633  Nitrotoluene degradation
kpc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KPNIH10_06925
Enzymes [BR:kpc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     KPNIH10_06925
  1.-  
   1.-.-  
    1.-.-.-  
     KPNIH10_06925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AIA35673
Position
complement(1435958..1436611)
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALKRYSTKAFDATKKLTAGEAEQLKTLLQYSPSSTNSQPWHFIVASTDEGKARV
AKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLQRVVDQEEADGRFATPDAKAANHKG
RTFFADMHRKELKDDDQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGVDFAILDEEFDLKA
QGYTSLVVVRVGHHSVEDFNATLPKSRLPQSTTITEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtatcggtcgctttgaagcgctattccaccaaggcctttgacgccacgaaa
aagctgactgccggggaagcggaacagctgaaaacgctgctgcagtacagcccgtctagc
accaactcccagccgtggcactttattgtcgccagcaccgatgaagggaaagctcgcgtg
gcgaaagccgccagcggcacctacgtgttcaacgaacgtaaaattcttgacgcctcgcac
gtggtggtgttctgcgcgaaaaccgcgatggacgacgcctggctgcagcgcgtggtggat
caggaagaggccgatggccgtttcgccaccccggacgcaaaagccgctaaccacaagggt
cgcactttctttgccgatatgcaccgcaaagagctgaaagatgacgatcagtggatggca
aagcaggtgtatctcaacgtcggcaatttcctgctgggcgtagcggcgatgggtctcgac
gccgtgccgattgaaggggtcgattttgcgatcctcgatgaggaatttgacctgaaagcc
cagggctacaccagcctggtggtggtccgggtcggccaccatagcgtagaagatttcaac
gctaccctgccgaagtcgcgtctgccgcagtcgacgaccattaccgagatttaa

DBGET integrated database retrieval system