KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_16175Help
Entry
KPNIH10_16175     CDS       T03788                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00010  Glycolysis / Gluconeogenesis
kpc00020  Citrate cycle (TCA cycle)
kpc00620  Pyruvate metabolism
kpc01100  Metabolic pathways
kpc01110  Biosynthesis of secondary metabolites
kpc01120  Microbial metabolism in diverse environments
kpc01130  Biosynthesis of antibiotics
kpc01200  Carbon metabolism
Module
kpc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH10_16175
   00020 Citrate cycle (TCA cycle)
    KPNIH10_16175
   00620 Pyruvate metabolism
    KPNIH10_16175
Enzymes [BR:kpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     KPNIH10_16175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AIA37426
Position
complement(3296671..3298314)
Genome map
AA seq 547 aa AA seqDB search
MSQQIESVKMALQELGINASGEFFYNPDYDLLIAHETSPELTGAARGVMTDSGAVAVDTG
IFTGRSPRDKYIVRDEQTRDTVWWADSGLGRNDNKPLSPDVWRSLKSLVAGQLSGKKLYV
IDAWCGASPDTRLGVRFVTEVAWQAHFVKNMFIVPSADELASFTPDFVVLNGAGCTNANW
QAQGMNSENFVAFNLSERIQLIGGTWYGGEMKKGLFSVMNYLLPQKGIASMHCSANRGEA
GDVALFFGLSGTGKTTLSTDPHRQLIGDDEHGWDDAGVFNFEGGCYAKTINLDPQAEPEI
YGAIRRNALLENVVVRADGSVDYADGSKTENTRVSYPLSHIDNIVKPVSRAGHPSKVIFL
AADAFGVLPPVSRLTTEQMQYHFLSGFTSKLAGTERGITQPTPTFSACYGAAFLLLHPTQ
YASVLAAKMAESGAEAWLVNTGWNGEGKRLSLRDTRSIISAILNGTTGPLREETIPVFGL
AIPQSIPGVDSAVLDPRNGWSSADKWQEKAESLAQLFMDNFKQYSDTEAGARLALAGPQL
QKSAVEA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaaattgaatcagtaaaaatggctctgcaggagctggggattaatgcaagc
ggcgaattcttttacaaccctgattacgatttgcttattgcacatgaaacctctcctgag
ctgaccggcgcggcccgcggcgtgatgaccgactctggcgctgtggctgttgataccggg
atcttcaccggccgttcgccgcgcgataaatacatcgtccgcgacgaacagactcgcgac
accgtctggtgggcagactccggcctcggccgtaatgacaataagccgttatcgccagac
gtgtggcgcagcctgaaaagcctggtcgcgggccagctgagcggcaaaaaactgtacgtc
atcgacgcctggtgcggcgccagcccggacacccgtcttggcgtacgcttcgtcaccgag
gtggcgtggcaggcccactttgtcaaaaacatgtttatcgtgccaagcgccgacgagctg
gccagctttacgccagacttcgtggtgctcaacggcgcgggctgcaccaatgccaactgg
caggcgcaggggatgaactccgagaactttgtcgcctttaatctcagcgagcgtattcag
ctcatcggcggtacctggtacggcggcgaaatgaagaaagggctgttctcggtcatgaac
tacctgctgccgcagaaaggcatcgcgtcgatgcactgctcggccaaccgtggcgaagca
ggggacgtggcgctgttcttcggcctctccgggaccgggaaaaccaccctgtcgaccgat
ccgcatcgtcagctgatcggcgatgatgagcacggttgggacgatgccggcgtgtttaac
ttcgaaggcggctgctacgccaagaccatcaatctcgatccgcaggcggagccggagatt
tatggcgccatccgccgcaatgcgctgctggaaaacgtggtggtgcgcgctgacggcagc
gtggattatgccgacggcagcaaaaccgaaaacacccgcgtctcctatccgctgtcgcat
atcgacaatatcgtcaagccggtgtcccgcgcgggccatccgtcgaaggtgattttcctt
gccgccgatgcgtttggcgtcctgccgccggtctcccgtctgaccaccgagcagatgcag
taccatttcctgtcgggtttcacctcgaagctggcgggcaccgagcgcggcattacccag
ccgacgccgaccttctccgcctgctatggcgcggcgttcctgctgcttcacccgacccag
tacgccagcgtcctggcggcgaagatggcggaatccggtgccgaagcctggctggtcaac
accggctggaacggcgaaggcaaacgcctgtcgctgcgcgatacccgcagcatcattagc
gcgatcctcaacggcactaccggcccgctgcgcgaggagaccatcccggtgttcggtctt
gcgatcccgcagagcattccaggggtagacagcgcggtgctggatccgcgtaatggctgg
agttcagcggataaatggcaggagaaggccgagagcctggctcagctgtttatggataac
ttcaagcagtacagcgataccgaagcgggcgcgcgtctggcgctggccggtccgcagctg
cagaagagcgcggtcgaagcctga

DBGET integrated database retrieval system