KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_17415Help
Entry
KPNIH10_17415     CDS       T03788                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00030  Pentose phosphate pathway
kpc00480  Glutathione metabolism
kpc01100  Metabolic pathways
kpc01110  Biosynthesis of secondary metabolites
kpc01120  Microbial metabolism in diverse environments
kpc01130  Biosynthesis of antibiotics
kpc01200  Carbon metabolism
Module
kpc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPNIH10_17415
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPNIH10_17415
Enzymes [BR:kpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     KPNIH10_17415
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     KPNIH10_17415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA F420_oxidored Shikimate_DH 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Motif
Other DBs
NCBI-ProteinID: AIA37658
Structure
PDB: 

Position
complement(3553135..3554541)
Genome map
AA seq 468 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENSGKKLVPYYTVQEF
VESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFT
KKDDEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAAS
KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAQNADIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
FSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWLD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaacagatcggggtagtcggtatggccgtgatggggcgtaaccttgcgctg
aacatcgaaagccgtggttataccgtctccgttttcaaccgctcccgtgaaaagaccgaa
gaagtgattgccgaaaactcaggcaagaagctggtcccttactatacagtacaagagttc
gttgaatcccttgaaacaccacgccgtatcctgttgatggtgaaggccggggctgggacc
gacagcgccatcgattccctgaagccttacctcgacaaaggcgacatcatcattgatggc
ggcaacaccttcttccaggacaccatccgtcgtaaccgtgaactgtctgccgaaggtttt
aactttatcggtaccggtgtttccggtggtgaagagggcgctctgaaagggccttccatc
atgcctggtgggcagaaagaagcctatgagctggtcgctccgattctgaagcagattgct
gcagttgctgaagacggtgagccatgtgtgacctatatcggtgctgacggtgctggccat
tatgtgaagatggttcataacggcatcgagtatggcgacatgcagctaattgctgaagct
tatgcgctgttgaaaggcggtctggctctttccaacgaagagctagcgcaaaccttcacc
gaatggaacgaaggtgaactgagcagctacctgatcgatattaccaaagatatcttcacc
aagaaggatgacgagggtaaatacctcgtcgatgtcattcttgatgaagcggcaaacaaa
ggtaccggtaagtggaccagccagagctcactggatctcggcgaacctctgtctctgatc
accgagtccgtgtttgctcgttatatctcttcgcttaaagaccagcgtgtagccgcgtcg
aaagtgctgagtggtccgcaggctcaaccggccggtgataaagcggaatttatcgaaaaa
gttcgtcgcgcgttgtacctcggtaaaatcgtttcctatgctcagggcttctcccagctg
cgagctgcttctgatgaatacaactgggatctgaactacggcgagatcgctaagattttc
cgcgctggctgcataattcgtgcgcagttcctgcagaagatcaccgatgcttatgcgcaa
aacgctgacattgctaacctcttgcttgcgccgtacttcaaacagatcgctgatgactat
cagcaagcgctgcgtgatgtcgtggcttatgccgtgcagaatggtattccggtaccgacg
ttctctgccgcaattgcctactacgacagctaccgttccgcagttctaccagctaatctg
attcaggctcagcgtgattactttggtgcgcacacctataagcgtaccgataaagaaggc
gttttccatactgagtggttagattaa

DBGET integrated database retrieval system