KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_18390Help
Entry
KPNIH10_18390     CDS       T03788                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00130  Ubiquinone and other terpenoid-quinone biosynthesis
kpc00627  Aminobenzoate degradation
kpc01100  Metabolic pathways
kpc01110  Biosynthesis of secondary metabolites
kpc01120  Microbial metabolism in diverse environments
kpc01220  Degradation of aromatic compounds
Module
kpc_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    KPNIH10_18390
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KPNIH10_18390
Enzymes [BR:kpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     KPNIH10_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like DUF3018 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AIA37847
Position
complement(3790042..3790611)
Genome map
AA seq 189 aa AA seqDB search
MKRLIIGISGASGAIYGVRMLQVLRDVPDIETHLILSQAARQTLAMETDYSVREVQALAD
VVHDARDIAASISSGSFKTAGMVILPCSMKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPFHLGHLRLLVQAAELGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFDISLEH
DLFTRWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgactgattattggcatttccggcgccagcggcgccatttacggcgtgcggatg
ctgcaggtgctaagagatgtgccggatattgaaactcatctcatcctcagccaggcggcg
cgccagacgttggccatggagaccgactactccgtacgtgaggtgcaggcgctagccgat
gtggtgcatgacgcccgcgatatcgccgccagtatctcttccggttcttttaaaaccgcc
gggatggtgattttaccctgctcaatgaagacgctctcgggcattgtccatagctatacg
gatggcctgctgacccgggcggcggatgtcgtgctgaaagagcgtcgtccgctggtgctc
tgcgtgcgggaaacgccgttccatttgggccatctgcgtctgctggttcaggctgcagag
ctgggggcggtgataatgccgccggtaccggctttttaccaccggccacaaagcctggac
gatgtcatcaaccagaccgtcaatcgggtactcgatcaatttgatattagtctggagcac
gacttgtttacccgctggcagggggcctag

DBGET integrated database retrieval system