KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_20965Help
Entry
KPNIH10_20965     CDS       T03788                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpc03016]
    KPNIH10_20965
Enzymes [BR:kpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     KPNIH10_20965
Transfer RNA biogenesis [BR:kpc03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    KPNIH10_20965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIA38333
Position
complement(4302100..4302894)
Genome map
AA seq 264 aa AA seqDB search
MLEIIYQDDWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIRKRYHAIVRGWLMEEALLDYPLVEELDRIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTSRYGLVELEPKTGRKHQLRRHLAHLRHPILGDSK
HGDLRQNRSAAEHFGCHRLMLHASELSLTHPFTGEPLTLRAGFDDVWMRALSQFGWRGLL
PLNERVEFADDSGQDEENKVNPGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatctaccaggacgactggctggtggcggtcaacaaaccctcgggctgg
ctggtgcatcgcagctggctcgatcgcgacgagaaagtggtggtgatgcagaccgtgcgc
gaccagatcggtcagcacgtttttaccgctcatcgtctcgaccggcccacctccggcgtg
ctgctgatgggattgtcgagcgaggcgggccggctgctggcgcaacagttcgagcagcac
cagatccggaagcgctaccatgcgatcgtccgcggctggctgatggaagaggcgctgctg
gattacccgctggtagaggagctggatagaatcgccgataagttcgcccgcgaagataaa
gggccgcagccagcggtaacccactaccgcggtctggcgacagtggagatgccagtggcg
actgggcgctatcccacctcgcgctatgggctggtggaactggagccgaaaaccggccgc
aagcaccagctgcgccgtcatctggcccacctccgtcatccgatcctcggcgacagcaag
cacggcgatctgcggcaaaaccgcagcgccgcggaacatttcggctgtcaccgcctgatg
ctgcacgccagcgagctgtcgttaacccatccttttaccggcgagccgctgaccctgcgc
gccggttttgacgacgtctggatgcgcgcgctgtcgcagtttggctggcgcgggcttctc
ccgctaaatgaaagggttgagtttgccgacgacagcggtcaggatgaagagaataaggtc
aatccagggagataa

DBGET integrated database retrieval system