KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_21590Help
Entry
KPNIH10_21590     CDS       T03788                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00071  Fatty acid degradation
kpc00072  Synthesis and degradation of ketone bodies
kpc00280  Valine, leucine and isoleucine degradation
kpc00310  Lysine degradation
kpc00362  Benzoate degradation
kpc00380  Tryptophan metabolism
kpc00620  Pyruvate metabolism
kpc00630  Glyoxylate and dicarboxylate metabolism
kpc00640  Propanoate metabolism
kpc00650  Butanoate metabolism
kpc00900  Terpenoid backbone biosynthesis
kpc01100  Metabolic pathways
kpc01110  Biosynthesis of secondary metabolites
kpc01120  Microbial metabolism in diverse environments
kpc01130  Biosynthesis of antibiotics
kpc01200  Carbon metabolism
kpc01212  Fatty acid metabolism
kpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH10_21590
   00630 Glyoxylate and dicarboxylate metabolism
    KPNIH10_21590
   00640 Propanoate metabolism
    KPNIH10_21590
   00650 Butanoate metabolism
    KPNIH10_21590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNIH10_21590
   00072 Synthesis and degradation of ketone bodies
    KPNIH10_21590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNIH10_21590
   00310 Lysine degradation
    KPNIH10_21590
   00380 Tryptophan metabolism
    KPNIH10_21590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNIH10_21590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNIH10_21590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH10_21590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpc04147]
    KPNIH10_21590
Enzymes [BR:kpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNIH10_21590
Exosome [BR:kpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH10_21590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIA38454
Position
complement(4432336..4433514)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVVKALVEKTGIDPHSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREFGISRELQDAWAL
SSQHKARKAIDSGRFRDEIVPVVTEHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDDVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtcgtgatcgtcggcgcgctgcgaacgccgattggctgctttcagggcgca
ttatcgcgccattcagccgtcgagctggggagcgtggtggtgaaggcgctggtggagaaa
acgggaatcgatccgcacagcgtggatgaggtgatcctcggccaggtgctgaccgcgggg
accggacaaaatccggcgcgtcagtccgctattcgcggtgggctgcctaacaccgtatcg
gctatcaccattaacgatgtctgcggttccggcctgaaggctctgcacctcgctacccag
gcgatccagtgcggggaagcggacgtggtgatcgctggcggccaggagaatatgagccgc
gctccgcatgtgcttaccgacagccgcaccggcgcccagctgggcaacagccagctgatt
gacagtctggtgcatgatgggctgtgggatgctttcaacgattatcatatgggcgtcacg
gcggaaaacctggcccgggaatttggcatcagtcgcgagctgcaggacgcctgggcgctc
agctcacagcataaggcgcgcaaggcgattgattccggtcgctttcgcgatgagatcgtc
ccggttgtcaccgagcataacggcgcggcgcgcaccgtggataccgatgaacaaccgcgg
gtggatgccagcgcggaagggctggccagcctgcagcccaccttcgatcgccttggatcg
gtaaccgccggcaacgcctcaagcatcaatgacggcgcggcggcggtaatgatgatgagc
gaggctaaagcgctggagctggggctgccgatccttgcgcggatccgcgccttcgccagc
gtcggcgtcgatccggcgctgatgggcattgccccggtgcatgccacccgtcgctgtctg
gagcgggccggctggcggctggacgacgtcgatctgatcgaagccaatgaggcctttgcc
gctcaggcgatctcggttggccgggtactggagtgggatgagcgccgggtcaacgtcaac
ggcggcgcgatcgccctcggccaccccatcggcgcctccggctgccggattctggtgtcg
ctggtgcatgaaatgatcaagcgcgatgcccgcaaaggtctggcgacgctgtgcattggc
ggcggtcagggcgtggcgctggcggtagaacgcgcatag

DBGET integrated database retrieval system