KEGG   Kangiella profundi: CW740_06360Help
Entry
CW740_06360       CDS       T05254                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
kpd  Kangiella profundi
Pathway
kpd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:kpd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CW740_06360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpd01007]
    CW740_06360
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpd03016]
    CW740_06360
   03029 Mitochondrial biogenesis [BR:kpd03029]
    CW740_06360
Enzymes [BR:kpd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     CW740_06360
Amino acid related enzymes [BR:kpd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CW740_06360
Transfer RNA biogenesis [BR:kpd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CW740_06360
 Prokaryotic Type
   Other AARSs
    CW740_06360
Mitochondrial biogenesis [BR:kpd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CW740_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: AUD78888
UniProt: A0A2K9B1V8
Position
complement(1365570..1367336)
Genome map
AA seq 588 aa AA seqDB search
MLVSIEQQLSQLFADAFESLELPRELGDVQRSNRPDLGHYQCNGAMAAAKLGAGNPFVTA
EKVVAALSENSLIEKVDVVRPGFINVFVNAESLAKTLETFGSDHTFGCHEDKSNTKVMID
FGGPNVAKSMHVGHLRTAIIGDSLQRIFRFKGYNVVSDAHLGDWGTQMGMLIEGLKKRQP
ELVYFDADFNGPYPEESPVTIQDLEEIYPQESGLCKSDETAAEKARQATLELQNGRAGYR
ALWQHFVNVSVATLKRDYGELGVSFDLWKGESDADPFIPKVIQELEDKGLAVRDQGALIV
PFKDEQGEAVMPPLILRKSDGAVMYGTTDLATLYERVYDDHANLVLYVVDGRQQQHFKQV
FAAADLMGMNANTEYEHTYFGTVNGKDGKPFKTRSGGVMKLHDLIQMAKEEARKKLAESN
FGDDFNDDEKEEIAHKVAISTLKFADLRNYRIKDYIFDLEKFSEFEGKTGPYLLMQVARI
KSILRKAEEAGAKPGDLMPTTDNELDLTFGLLDFPSALDKTVDKRAPHYLCEHLYNLAQQ
FSSFYQKQHIMNEPDKARQASLLRLSQICLAQLEMGLELLGIETLERM
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtatctatcgaacaacaactcagccaattatttgccgatgcatttgaaagtctt
gaactgccacgtgagcttggcgatgttcagcgttcaaaccgtcctgatttaggccactat
caatgtaatggtgccatggctgcagctaagctgggtgcaggcaatcctttcgttactgct
gaaaaagtggttgcagcgttatctgaaaatagtctgattgagaaagtcgacgttgttcgc
cccggtttcatcaacgtttttgtcaatgctgagtcgctagcgaaaacactggaaacgttc
ggctccgatcataccttcggttgtcacgaggataaatccaacacaaaagtcatgatcgac
ttcggtggccctaatgttgccaagtccatgcacgttgggcatttacgcacagccatcatt
ggcgactcattacagcgtattttccgttttaaaggctataacgttgtttccgatgctcac
ttgggagattggggcacgcaaatgggtatgctgatagaaggtttgaaaaagcgtcagccg
gagttagtgtattttgatgccgactttaacggtccatatcccgaagagtcaccagtaacc
attcaggatttagaagaaatttatcctcaggaatcaggcttgtgtaagtctgatgagacc
gccgcagagaaagcccgtcaggcgacacttgagttacaaaatggtcgtgctggttatcgt
gccttgtggcagcactttgttaatgtttcggtcgcaaccttaaaacgtgactatggcgag
ctgggtgttagttttgatttgtggaaaggtgaaagtgatgccgatccatttattcctaaa
gtcattcaggaacttgaagacaaaggtcttgcggtccgtgaccaaggcgctttgattgtg
ccgtttaaagacgagcagggtgaggcagttatgccacctctaatcttgcgcaaatctgat
ggggcagtgatgtatggcacaacagatttagcaacgctttatgagcgtgtttatgacgat
catgccaatcttgttctttacgtagttgatggtcgtcagcagcagcactttaaacaggtt
tttgcagcagcggatctgatgggtatgaacgccaataccgaatacgaacatacttacttc
ggtacggtgaatggcaaggacggcaagccctttaagactcgctctggcggtgtcatgaaa
ctccatgaccttatccagatggcaaaagaagaagcccgtaagaagttggcagaaagtaac
ttcggtgacgatttcaatgacgatgaaaaagaagagatcgctcataaagtagctatttca
accttgaagtttgctgatctaagaaattaccgtatcaaagactatatttttgatttggaa
aaattcagtgaatttgaaggcaagacaggtccatacttgttgatgcaggttgctcggatt
aagtcaatcttacgtaaggctgaagaggctggtgcaaaaccgggtgatttaatgccaacc
acggataatgaattggatttaacctttggtcttttggactttccttctgctcttgataaa
accgtcgataagcgtgcaccgcattatctttgtgagcatctttataaccttgcgcaacag
ttcagttctttctatcagaagcagcacataatgaatgaacctgacaaagcacgtcaggct
agcttattacgtttgagtcaaatttgtttggcacaacttgaaatgggcctagagttattg
ggcatcgaaactctggaacgtatgtaa

DBGET integrated database retrieval system