KEGG   Klebsiella pneumoniae 342: KPK_0152Help
Entry
KPK_0152          CDS       T00772                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00051  Fructose and mannose metabolism
kpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPK_0152 (mtlD)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     KPK_0152 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACI07884
UniProt: B5XMV6
Position
complement(155279..156427)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIELTFADVNQTVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDEVVDLIAEVDLVTTAVGPVVLERIAPAIAKGLAKRKAQGSERPLNIIAC
ENMVRGTTQLKGHVFNALAEEDKAWVEAHIGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVQGAMEESGAVLIKRYAFDPQKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDAASDVVAEAVNDYNAEK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggacgtggctttatcggtaaattgctg
gccgacgcgggcattgaactgacgttcgccgatgtcaatcagaccgtacttgatgccctg
aatgcccgtcatagctatcaggttcacgtcgtcggtgagaatgagcaagtggatactgtc
tccggcgtcaatgccgtcagcagcatcggcgatgaggttgtcgacctgatcgctgaggtg
gatctggtcaccaccgccgtcggtcccgtcgtactcgagcgcatcgccccggccatcgcc
aaagggctggcgaagcgcaaagcgcagggcagcgaacgtccgctgaacattatcgcctgc
gaaaatatggtgcgcggcaccacgcagttaaaaggtcacgtgtttaacgcgctggcggaa
gaagataaagcgtgggttgaagcgcatatcggctttgtcgactctgccgttgaccgtatt
gtgccgccatcggcttccgccacccatgacccgctggaagtcaccgtggaaaccttcagc
gagtggattgttgataagacgcagttcaagggcgcgctgccgactatcccgggaatggaa
ttaactgataacctgatggcatttgtcgaacgcaagctcttcaccttgaacaccgggcat
gctataaccgcctacctcggaaaactggcgggccatcagacgattcgcgacgcgatcctc
gatgagaaaattcgtgccgtcgtgcagggcgcgatggaagagagcggcgcggtgctgatc
aaacgttacgcctttgacccgcagaaacatgcggcttatatccagaaaattcttggacgt
ttcgagaacccgtacctgaaagacgatgttgagcgcgttggccgtcagccgctgcgcaaa
ctgagcgctggcgaccgtttaattaagccgctgctgggtaccctggaatacggtctgccg
caccgcaacctggtgaaagggattgcagcggcgatgcatttccgtagcgaagacgatccg
caggcgcaggagctggcagccctgatcgccgacaaggggccgcaggccgcgctggcgcag
atttccggcctggatgccgcaagtgatgtcgtcgcggaggccgttaacgactacaacgcg
gaaaaatga

DBGET integrated database retrieval system