KEGG   Klebsiella pneumoniae 342: KPK_0342Help
Entry
KPK_0342          CDS       T00772                                 

Gene name
envZ
Definition
(GenBank) osmolarity sensor protein EnvZ
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPK_0342 (envZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kpe01001]
    KPK_0342 (envZ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpe02022]
    KPK_0342 (envZ)
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     KPK_0342 (envZ)
Protein kinases [BR:kpe01001]
 Histidine kinases
  OmpR family
   KPK_0342 (envZ)
Two-component system [BR:kpe02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   KPK_0342 (envZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACI10975
UniProt: B5XTT3
Position
377409..378764
Genome map
AA seq 451 aa AA seqDB search
MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT
EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD
LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS
GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL
EIGSSERGGLLIRAWLPVHRMLAPMKPAKES
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgtgcgcttttcgccgcgcagctcctttgctcgcacgctgctcctgatcgtc
accttgctgttcgtcagcctggtgacgacctatctggtggtactgaatttcgcgatcctg
ccgagtctccagcagtttaataaagtattggcctacgaagtccgtatgctgatgaccgac
aaactgcaactggaggatggcacccagctggtggtgcccccggcgtttcgtcgtgaaatt
tatcgtgagctggggatttcgctctattccaatgaagcggcggaagacgcagggctgcgc
tgggcgcagcattatgaattcttaagccagcagatggcgcatcagctcggcggccccact
gaggtgcgggtggaggtcaataaaagctcccccgtggtgtggctgaagacctggctgtcg
cccaatatctgggtgcgggtaccgctgaccgagatccatcagggcgacttctcgccgctg
ttccgctataccctggcgatcatgctgttggcgataggcggcgcctggctgtttatccgt
attcagaaccgtccgctggtagatctcgaacacgcggcgctgcaggtcgggcgcggtatt
atcccgccgccgctgcgagagtacggcgcctctgaggtgcgctcggtgacccgcgccttt
aaccatatggccgcgggcgtgaagcagctggctgacgaccgtacgttgctgatggccggg
gtcagccacgatttacgtactccgctgacgcgcattcgtctggccaccgagatgatgggc
gagcaggacgggtatctcgcggagtcgattaacaaagatatcgaagagtgcaacgccatc
atcgagcagtttattgactatctgcgcaccgggcaggagatgccgatggagctggcggac
ctcaatgcggtgctgggggaagtgatcgccgcagagagcggctatgaacgtgagatcgcc
actgccctgcaggccggtgaaatcccggtacgcatgcacccgctttctatcaagcgtgcg
ctggcgaatatggtggtgaatgcggcccgctacggcaatggctggatcaaggtcagcagc
ggcagcgaagcgagccgggcctggttccaggtggaagatgacgggccggggatcaaacct
gagcagcgcgaacatctgttccagccgtttgtacgcggcgatagcgcccgcagtaccagc
ggcaccgggctggggctggcgattgttcagcgtattatcgacaatcacaacggccggctg
gagattggctccagcgaacgcggcggattactgatccgcgcctggctgccggtgcaccgg
atgctggcgccgatgaaacccgccaaagagagctga

DBGET integrated database retrieval system