KEGG   Klebsiella pneumoniae 342: KPK_0844Help
Entry
KPK_0844          CDS       T00772                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00071  Fatty acid degradation
kpe00072  Synthesis and degradation of ketone bodies
kpe00280  Valine, leucine and isoleucine degradation
kpe00310  Lysine degradation
kpe00362  Benzoate degradation
kpe00380  Tryptophan metabolism
kpe00620  Pyruvate metabolism
kpe00630  Glyoxylate and dicarboxylate metabolism
kpe00640  Propanoate metabolism
kpe00650  Butanoate metabolism
kpe00900  Terpenoid backbone biosynthesis
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01200  Carbon metabolism
kpe01212  Fatty acid metabolism
kpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPK_0844
   00630 Glyoxylate and dicarboxylate metabolism
    KPK_0844
   00640 Propanoate metabolism
    KPK_0844
   00650 Butanoate metabolism
    KPK_0844
  Lipid metabolism
   00071 Fatty acid degradation
    KPK_0844
   00072 Synthesis and degradation of ketone bodies
    KPK_0844
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPK_0844
   00310 Lysine degradation
    KPK_0844
   00380 Tryptophan metabolism
    KPK_0844
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPK_0844
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPK_0844
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPK_0844
Enzymes [BR:kpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPK_0844
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPK_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACI09086
UniProt: B5XUL7
Position
849620..850798
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVLKALVEQTGIDPQSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQHKARKAIDSGRFRDEIVPVITEHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDDVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtcgtgatcgtcggggcgctgcgaacgccgattggctgctttcagggcgcc
ttatcgcgccattcagccgtcgagctggggagtgtggtattgaaagcgctggttgagcag
acagggatcgatccgcagagtgtggatgaggtgatcctcggccaggtgctgaccgccggt
accgggcaaaaccccgcgcggcagtccgcaattcgcggcgggctgcctaacactgtatcg
gccattaccataaacgacgtctgcggctccggcctgaaggctttgcacctcgccacccag
gcgattcagtgcggggaagcggatgtggtgatcgccggcggccaggagaatatgagccgc
gctccgcatgtactcaccgacagccgcaccggcgcccagttgggcaatagccagctgatt
gacagcctggtgcatgacggcctgtgggatgccttcaacgattatcatatgggcgttacg
gcggaaaacctcgcccgggaatacggcatcagccgcgagttgcaggacgcctgggcgctc
agctcacagcataaggcgcgcaaggcgattgattccggccgctttcgcgacgagattgtc
ccggttattaccgagcataacggcgcggcgcgcaccgtggataccgatgaacaaccgcgg
gtggatgccagcgcggaaggattggccagcctgcagcccaccttcgaccgcctcgggtcg
gtgaccgccggcaacgcctccagcatcaacgacggcgcggcggcggtcatgatgatgagt
gaagccaaagcccttgaactggggctgccgatcctcgcgcggatccgcgccttcgccagc
gtcggggtcgatccggcgctgatgggcattgccccggtgcacgccacccgtcgctgtctg
gagcgggccggctggcggctggacgacgtcgatctgatcgaagccaatgaggcctttgcc
gctcaggcgatctcggttggccgggtactggagtgggatgaacggcgggtcaacgtcaac
ggcggggcgatcgccctcggtcaccccatcggcgcctccggctgccggatcctggtatcg
ctggtgcatgaaatgatcaagcgtgatgcccgtaaagggctggcgacgctgtgcatcggc
ggcggtcagggcgtggcgctggcggtagagcgcgcctga

DBGET integrated database retrieval system