KEGG   Klebsiella pneumoniae 342: KPK_0852Help
Entry
KPK_0852          CDS       T00772                                 

Gene name
cscA
Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00052  Galactose metabolism
kpe00500  Starch and sucrose metabolism
kpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPK_0852 (cscA)
   00500 Starch and sucrose metabolism
    KPK_0852 (cscA)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPK_0852 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ACI09078
UniProt: B5XUM5
Position
858514..859950
Genome map
AA seq 478 aa AA seqDB search
MMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYS
TQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHG
DPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAREG
DTGQVRLYRSTDLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAEGFS
NRNLFQSGYLIGEWQPGQRFIRHGEFREMDHGHDFYAPQSFATPDGRRIVIGWLDMWESP
LPEQQDGWAGMLSLPRELSLSADNRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNC
EAMEVHLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVVERYYPQFGLCGTRSVPLTAG
ADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQVPCRELALFAWSGSAALTEAGAWQLE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgctc
aatctgcgctggtatccacactatcacctggcggcccgcgccgggtggatcaacgaccct
aacggtctggtgtggttcgacggctggtaccatgccttttatcagcatcacccgtattcc
acccagtgggggccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggag
cacctgccggtggcgctggcgccggaggggccggaagataaagacggctgcttctccggt
tcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggc
gatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacggg
atccactttgagcgccaggggatggtggtcgacacccctccaggcatgcaccacttccgc
gacccgaaggtctggcgggaaggggatagctggtacatgatcgtcggcgcgcgcgaaggc
gataccggccaggtgcggctgtaccgttcaaccgatctgcgccagtggcaggatgcgggc
gtgctggatgaagcggaaagcaccatgggctacatgtgggagtgcccggacttcttcact
ctcaacggtaagcgcgtcctgatgttttccccacaggggatgcaggccgaagggttcagc
aaccgcaatctgttccagagcggctatctgatcggcgagtggcaaccggggcagcgtttt
attcgccacggcgaattcagggagatggaccacggccacgatttctatgccccgcaaagc
ttcgccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccg
ctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctg
agcgcggataaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcc
tggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgc
gaggcgatggaggtgcacctgcgctgggactgcgcccgcagcagcgctgagcagtatggt
ctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctggtggtg
gagcggtattatccgcagtttggcctgtgcgggacgcgcagcgtgccgttgaccgccggg
gcggatctcaacctgcggatatttttcgatagctcttcggttgaggttttcgtcaatgat
ggcgaagcctgcctgagcagccgtatctatccgcaggtcccttgccgtgaattagcgtta
tttgcctggagcggctcagctgcattaactgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system