KEGG   Klebsiella variicola 342: KPK_0937
Entry
KPK_0937          CDS       T00772                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
kpe  Klebsiella variicola 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_0937
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_0937
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ACI10685
UniProt: B5XUW0
Position
complement(943537..944619)
AA seq 360 aa
MDRTPQPARTGLTERLAPDINRINFYRFCQLLEQSQPQTPLLGSTTNPADDPVRFRPHPG
MGFPVSELKSVEQDLDHPDAPPTVRTTFLGLYGVDSPLPTAYLDYIAQRRDGHEAMMAFL
DIFNHRFITQYYRIWRKYNYPTSFEPGAVDNISRCLLGLIGLGIPGSENHIATPVSRFLA
LLSVMRLPTRTAEGITALVRLLAPQTKATVIPHDPQQIVLPEPAGLSKRSRICLKTRALL
GNTGTDVNSQLLLKLYTEDDGEARGWLPGGQLHTDLLVLLRVYLGWRYQARLQLTLPVSL
LPPVQLGKQRVQVSRTGVLRASFAAPVAGTVTVSLGRYQGLIPTSSTRNRESVTHVSYTL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggacagaacaccacagccagcgcgtaccgggctgacggaaaggcttgctccggacatt
aaccgaattaacttttaccgtttctgccagcttcttgaacaaagccaaccacagacgcca
ctgctggggagcacaaccaatccggcagacgatcctgtccgttttcgtccacatccgggg
atggggttcccggtcagcgaactaaaaagcgtcgaacaagatttggatcatcctgacgcg
ccacccacggtgcgcaccacgtttctggggctgtacggtgtggattcaccgctgccgaca
gcttatctcgactacatcgcgcagcgccgggacggccatgaagcgatgatggcgtttctg
gacatttttaaccatcgctttatcactcagtactatcgtatctggcgcaaatataattac
cctacgtcgtttgaaccgggagccgtggataatatttcccgctgcctgctggggttgatt
ggtctgggcattcccggcagcgaaaatcatatcgccacgccggtctcgcgttttcttgca
ttactcagcgtgatgcgtctgccgacgcgtacagcagaaggcataacggcgctggtcaga
ttactggccccccagacgaaagcgacagttatcccgcacgatccacaacagattgtcctg
cctgaacctgcgggtttatcaaaaagatcgcgtatttgcctgaaaactcgggcactgctg
ggcaacaccggcactgacgttaacagccagttactgctgaagctatataccgaagacgac
ggagaggcacgcggctggctgccgggcgggcaactacataccgacctgctggtgctgttg
cgtgtctatctgggctggcgctaccaggcccgcctgcaactgaccttgcccgtcagtctg
ctgcctccggtacagttgggaaaacagcgcgttcaggtaagccgaacgggtgtgctgcgg
gcgtcttttgctgccccagtcgccggtacggtcacggtcagtctcgggcgttatcaggga
ctcatacccacatcatccacccgcaacagggagagtgttactcatgtttcttacacccta
taa

DBGET integrated database retrieval system