KEGG   Klebsiella variicola 342: KPK_0938
Entry
KPK_0938          CDS       T00772                                 

Gene name
vasA
Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
kpe  Klebsiella variicola 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_0938 (vasA)
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_0938 (vasA)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACI07871
UniProt: B5XUW1
Position
complement(944583..946343)
AA seq 586 aa
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSLSVVELLTDHRQMKQSETLSDFQVLSRPVGE
HRTRCCYSATRVITLLPLALPEVSLQYEQDGRSVIRLRFECSPLAGDGSQIDLSRLPLYL
NADSPLACALHRALTLGVQQIWFRLPGEERRTLDGYFSPMGFGKDDPLWPKGESAFSGYQ
LLLEYFTFREKFMFVALNGLENVVWPAGMSGFEIDVVLAESWSHDLPFSTENIRLHCVPV
INLFPLEADPLHLSPLENEYLLRPMRIQDGHTEIYSVDNIISSRHTGSQAYVPFSSFRHR
GGMLRHDSPERYYHTRVKRGPSGLHDTWLILGGDAFDIDRLLEDETLSLSLTGTNGQLPR
KALQSTVLDTPVYATQHTLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEI
LRGTLALYDWTESEMNRRRLEAIVDVQHHLIQRFEKGFLLRGVDIQVTLDSNGFAGEGDI
TLFGELLHRFFALYADIHLFTQLTLILQPTGKCLQWTEHHSQRVPG
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggatgatttaacccaacgctattacgaagccgaaatgcgctacctgcgtgaagcgggt
aaagagtttgcgcaagcgtatcctgatcgcgccgctatgctcaatctcgataagcccggc
gcgcgcgacccttatgtcgaacgtctcttcgaaggtttcgccttcctgatgggccgcctg
cgggaaaaactggatgacgatctacctgaactgactgaggggctggtgagcctcctgtgg
cctcattatctgcgtacaatcccgtcgctgtcggtggtggaactgttaaccgatcatcgg
caaatgaagcagagcgaaacactgagtgattttcaggtgctctcgaggccggtcggcgaa
caccggacacgttgctgctacagcgccacgcgggttatcaccctgcttccgctggcttta
ccagaggtgtcgttacagtacgaacaggatggacgttcggttatccgtctgcgctttgag
tgcagcccgctggctggcgacgggtcacagattgatttatcgagactgccgctctatctc
aatgcggacagtccgctggcttgtgcattacaccgggcgctgacgctgggggtgcagcaa
atctggtttcgcctgccgggggaggaacgtcggacactggacggctatttttccccgatg
gggttcggtaaggacgatccgctctggccaaaaggcgaatcggccttcagcggctaccaa
ctgctgctggagtatttcaccttccgcgagaagtttatgtttgtcgcccttaacgggctg
gagaatgtggtctggccggcaggaatgagtggattcgaaattgacgtggtgctcgcggaa
agctggtctcacgatctgccgttcagcaccgaaaatatccgcctgcactgcgtaccggtg
atcaacctgttcccgctggaagccgatccactgcatctttctccgctggaaaatgaatac
ttgctgcgccccatgcgtattcaggacgggcatacggaaatttactccgtcgataatatt
atttcttcgcgacacaccggcagtcaggcatatgtgcccttttccagttttcgccaccgg
ggcgggatgttgcgtcacgattcgccggaacgttattaccatacgcgggtaaaacgcggc
ccttccggtttgcatgatacctggctgatccttgggggcgacgcattcgatatcgaccgc
ctgctggaagacgaaaccctgtccctgagtctgaccggaaccaacggtcagcttccgcgt
aaagcgctgcagagcacggtgctggacacccccgtctacgccacgcagcatacactgcgg
gtgcgcaacctgtgcgcgccgacgcagccctgttatcccccggcgcgtgaccgtttccac
tggcgggttctcagccacttaggctccaacttcctgtcaatgatggacaacgccgaaatc
ttgcgcggcacgctggcgctgtacgactggacggaaagcgaaatgaaccgacgccgtctg
gaggcaatcgttgacgttcagcatcacctgattcagcgttttgaaaaaggttttctactg
cgcggcgtggatattcaggtcacgctggacagcaacggtttcgccggcgaaggcgatatc
accctgtttggcgaactgctgcaccgctttttcgccctgtatgccgacatccacttattt
actcagttgacgctgattctgcaacctacaggaaaatgtttgcaatggacagaacaccac
agccagcgcgtaccgggctga

DBGET integrated database retrieval system