KEGG   Klebsiella variicola 342: KPK_2053
Entry
KPK_2053          CDS       T00772                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
kpe  Klebsiella variicola 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_2053
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_2053
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACI09322
UniProt: B5XW35
Position
2119415..2121178
AA seq 587 aa
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRL
REKIDDDLPELTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKMAETAPAGFEISSRPLG
PKNTVCRYRTTRDLTLNPLALEEAVMTAEPDGRSVLRLCFTCSELADWSQTDLRRLALYL
GEDAVTGSALHLWLTRRQAALYLRLPGRAERVSLDGYFSPGGFSEEDRLWPKGESAFSGY
QLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFSEVWQSDLPVSASSLRLHCVP
VINLFTLEADPLTISGLESEYLLRPKRMQDGHTEIYSVDSVTGSGRTGEARYVPFTRFRH
QGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWESDRALARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPVYPPAEDRYHWRVMSHLGTRFLNMMSSAE
VLRGTLSLYNWREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGD
VHLFGDMLNRFFALYADMNQFNQLTLIVQPEGKCIRWKENHSLRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgatttaaccctgcgatattttgacgctgaaatgcgctacctgcgcgaggcggca
aaagcgttcgcgcaggctcaccccgatcgggcggcgatgctggatctcgataaagccggt
acgccggacccttacgttgagcgcctgtttgaaggctttgccttttccgtaggtcgcttg
cgcgaaaaaattgatgatgatctgccggagctgaccgaggggctggtcagcatgctgtgg
ccgcactatttgcgcaccattccatcgctatcgatcgtggcgctgaccccaacgctgccg
gcgatgaagatggcggaaacggcgcccgccgggtttgagataagctcccgcccactgggg
ccgaaaaataccgtgtgccggtaccgaaccacccgcgatctgacgcttaatccgctggcg
ttagaggaggcggtgatgacggcagagccggacggacgttcggtcctgcggctatgcttc
acctgtagcgagctggcggactggtcgcagaccgatctccgccgcctggcgctgtacctg
ggggaagacgccgttaccggcagcgccctccatctgtggctgacccgacgccaggccgcg
ctgtacctgcgcctgccgggtcgggcagagcgggtaagcctcgacggctatttttccccg
gggggattcagcgaggaggatcgtttatggccgaagggggagagcgctttcagcggctat
cagctgctgctcgagtatttcacctttcgcgaaaaatttatgttcgtgcagctaaacggc
ctggaaaacatcaccctgccggcggggatatcgcatttcacgcttgaggtggtgttcagc
gaggtctggcaaagcgatttgcccgtcagcgcaagcagcctgcgcctgcactgtgtgccg
gtgattaacctgtttaccctcgaggccgatccgttgaccatcagcgggctggagagcgaa
tacctcctgcgtccgaagcgcatgcaggacgggcataccgaaatctattctgtcgacagc
gtgaccggctccgggcgcaccggggaggcacgctatgtgcctttcacccgctttcgtcac
caggggggaatgatgcgtcgccatgcgccggagcgctactaccacacccgcgtcaaacgg
ggcgtcaccggcatgcacgatacctggcttatcctcggcggacagcaatgggagtctgac
cgggcgctggcgcgggaaacggtctccttgcgcatcaccggcactaacggccagctgccg
cgccgggcgctacagagcacgctgctggatcgctgtgagtcgatatcagccacgccgctt
accgtccgcaatctctgtaagcccacattgccggtatatcccccggcggaagaccgctac
cactggcgggtcatgagccatctgggcacccgttttctcaatatgatgagcagcgccgag
gtactgcgcggtacgctgtcgctctacaactggcgggaggatgagctcaataatcgccgt
ctggacgctattctggcggtcagccatcaccgaattcagcgtttcgagcagggtttcctg
ctgcgcgggctggatatcgaagtgacgctcgacggtagcggatttaccggtgcgggcgat
gtccacctgtttggcgacatgctcaaccgctttttcgcactgtatgccgatatgaatcag
ttcaaccagctgacgctcattgttcaacctgaagggaaatgtatccggtggaaagagaat
cacagtctgcgcctgcccggctga

DBGET integrated database retrieval system