KEGG   Klebsiella variicola 342: KPK_2055
Entry
KPK_2055          CDS       T00772                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
kpe  Klebsiella variicola 342
Pathway
kpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPK_2055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_2055
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_2055
SSDB
Motif
Pfam: T6SS-SciN Lyx_isomer DUF1363 LPAM_2
Other DBs
NCBI-ProteinID: ACI09755
UniProt: B5XW37
Position
2122205..2122741
AA seq 178 aa
MAITADKPSARLLAFLMVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVN
NNAKGASLAMVVRIYQLKDRQAFDNTDYPSLFAGDGQALQADRVAEKDVRLRPGESVTVD
MPMETSAQFVAVAAMFIDPDLTQNSWRLVLTRDDLDPARPRIIEASQNQLTLHPLKEK
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcgattaccgcagataaaccctccgccaggttgctggcattccttatggttaccgtc
ttaaccggctgcggcctgacgcagaccgtgaaagacggcgccgtttccgtgacccagtcc
attttttacccccaggtgaaaaccctgcatctggatcttcgcgcccgggaaggcgtgaat
aacaacgccaaaggcgcctccctggcgatggtggtgcgtatttaccagcttaaggatcgg
caggcgtttgacaatactgactacccgtcgctgtttgctggcgatggccaggcgctgcag
gcggaccgggtggcggaaaaagatgttcgcctgcgtccgggcgaatcggtgaccgtcgat
atgcctatggaaaccagcgcgcagtttgtggcggtggcggccatgtttatcgatccagac
ctgacgcaaaacagctggcggctggtactcacccgggacgatcttgacccggcgaggccg
cgcattatcgaagccagccaaaatcaactgacgttgcacccgcttaaggagaagtga

DBGET integrated database retrieval system