KEGG   Klebsiella variicola 342: KPK_3062
Entry
KPK_3062          CDS       T00772                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
kpe  Klebsiella variicola 342
Pathway
kpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPK_3062
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_3062
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_3062
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: ACI08501
UniProt: B5XRR4
Position
complement(3113816..3116185)
AA seq 789 aa
MKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAA
SLTLQAPVAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNA
IYQDQSVPQIVEKILRERHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGI
WFRFTADTRLHIDVAEFCDSQQGYEKGLTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQV
STRDYNYREATADMSAQVDVTRGETTTFGEAYHWGDNYLTAGNAHDRHPAPESGAFYARL
RHERYLNGQTRMQATTSCPTLCPGQVLKVIGGEEVAGEFAEGVLVTAMHSHARRDADFAV
EFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDRARW
ETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVT
IRNDKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSDRRPRGEGFELR
TDSRGAIRAQKGIFISADGQAKAQGQVLAMEPAVSLLKGAVNQVTEWGSITQTHHNVIPD
TGPLSALTTGTSDLKQPTLLMSAPQGIAAVTPETTLLHSGNGLYLQSLGEVNITTAQRCS
LNASQAISLLAQQEGMRLVSAKGPLEVESHGEILSLTALKDITVQSTQGHLQLTAKNGIT
LGCGGAYIRLTPQGEVQIHGPGVISLKGQHDLQGPVSEAFPLPELPASVCKECLKKAQAL
AQGFVPREA
NT seq 2370 nt   +upstreamnt  +downstreamnt
gtgaaatcgttgttgttcagccataaccaccacctgctttcggtgaagggatgtgaagcc
gggcttgatgtgctggccttcgagggcgatgaagccctgagccagccgttccgctaccgt
attgaattcaccagcgcagaccatgccatcagcaaagagatgatgctgatgaaggcagcc
tccctgacgctgcaggcgccggtggctcagggcttcggcatcaatgttcagcaacccgtg
cgggtgatccagggcgtggtgacggggtttgaacggctcagtacctccagggatgaaacg
cactacgcgctgacgcttcagccgcgcctggcgctgcttaaccgctcgcaccagaacgcc
atttaccaggaccagtccgttccgcagattgtggaaaaaatcctccgcgagcgccacggc
ctgcgcggtcaggattttctgttctcactgacaaaaacgtatccgcgccgcgagcaggtg
atgcagtacggcgaggatgacctgcgctttatcacccggctgctgggtgaggtggggatc
tggtttcgctttaccgccgacacgcggctgcacatcgacgtcgctgagttctgcgacagt
cagcagggttatgagaaggggctgacgttgccttcggtcccgccgtcagggcagcagtcg
gccggggtggacgcggtgtgggagatggcatgccgccaccgtgtcgtggagcagcaggtc
agtacccgcgactacaactaccgcgaggcgacggcggacatgagcgcgcaggtggatgtc
acccgcggggagaccaccaccttcggtgaggcttaccactggggagataactacctgacg
gcggggaatgcccatgaccggcatccggcgccggagtccggggcgttttacgcccgcctt
cgccatgagcgttatctgaacggccagacccggatgcaggccaccaccagctgcccgacg
ctctgcccgggacaggtgttgaaggtcatcggcggagaggaggtggccggggagtttgct
gagggcgtgctcgtcacggcgatgcacagccacgcccggcgcgatgcggattttgcggtg
gagtttgccggcataccggacagcccggacgtcggctaccggcctgagcccggcgcgcgt
ccggtgatggccgggacgctgccggcccgcgtgaccagcacccgggaaaacgacacctac
gggcatatcgacaaacacggacgctaccgggtgaatatgctgtttgaccgggcgcgctgg
gaaaccgggttcgagagcctgtgggtccgtcagtcgcggccgtatgccggagacacttac
ggcctgcacctgccgctgctggcggggacggaggtggcgattggctttgaggatggtaac
cctgaccggccgtatatcgcgggcgtcctccacgactcggcgcacggcgaccacgtcacc
atccgcaatgacaaacgtaacgtcctgcgcaccccggccaacaacaaaatccgcctcgac
gatgagcgcgggaaagaacatatcaaggtcagcacggagtacggcggtaaaagccagctg
aacctggggcacctggtggacagtgacaggcggccgcgcggcgaaggctttgagctgaga
accgacagccggggagctatccgggcacagaaagggatatttatcagcgcggacggacag
gcgaaggctcaggggcaggtgctggcgatggagccggcggtcagtttgctgaaaggtgcg
gtgaatcaggtcacggaatggggcagcattacgcaaacccatcataatgttatcccagac
accggcccattaagcgcactgaccacaggcaccagcgatcttaaacagccgacattgctg
atgtcggccccgcaggggattgccgcagtcacgccggaaacaaccctcctgcacagcggt
aacgggctgtatctgcagagcctgggggaggtcaacatcaccacggcacagcgctgttct
ctgaatgccagccaggctatttcactgctggcgcaacaggaggggatgaggctggtctcc
gccaaaggtccgctggaagtagagtcgcacggcgagattctgtcgctgaccgcgctaaaa
gatatcaccgtccagtcaacccaggggcatctgcagttgacggctaaaaatggcatcacc
ctgggttgcggcggcgcatatatccgtcttaccccgcagggagaggtacagatccacgga
ccgggggtgattagccttaaggggcagcatgatttgcaggggccggtcagcgaggcgttt
cccttgcctgagctaccggcatcggtgtgtaaagagtgccttaaaaaagcccaggcgctg
gcgcagggcttcgtgccgcgggaggcatag

DBGET integrated database retrieval system