KEGG   Klebsiella variicola 342: KPK_3064
Entry
KPK_3064          CDS       T00772                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kpe  Klebsiella variicola 342
Pathway
kpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPK_3064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_3064
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_3064
SSDB
Motif
Pfam: T6SS_HCP Inhibitor_I24
Other DBs
NCBI-ProteinID: ACI07985
UniProt: B5XRR6
Position
complement(3119106..3119597)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHD
IKNPAYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggggcggacattaaagggtct
gtcgacgttcaggatcgtgaaggcagtatcgaagtggtggctcaggagcacaacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacgcgtatccatacgccgttcctg
ttcaccaaggagatcgactcctccagcccgtacctgtacaaggcagtgaccaccggccag
accctgaaatccgctgagttcaagtggtacagaatcaacgatgccggccaggaagtggag
tatttcaataccaaacttgagaacgtcaaggtggtgaaagtgaatcccctgatgcacgac
atcaaaaaccctgcctacgagaagcacaaccatctggaacagattgagctgcgctacgag
aagatcacctggacctataaagacggcaacatcattcactccgatagctggaacgaacgc
gccacagcgtaa

DBGET integrated database retrieval system