KEGG   Klebsiella variicola 342: KPK_3068
Entry
KPK_3068          CDS       T00772                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
kpe  Klebsiella variicola 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_3068
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_3068
SSDB
Motif
Pfam: VipB VipB_2 PaaA_PaaC
Other DBs
NCBI-ProteinID: ACI11108
UniProt: B5XRS0
Position
complement(3123341..3124885)
AA seq 514 aa
MSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLAPASHLGDINDFLDDAALSEAPAAE
RLTAAMQVFMDRIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWR
GLKQLVDNTDYRQNVKTEILDVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIG
SVISAYEFDASPQDVALLRNISRVSAAAHMPFIGAVGPAFFLKETMEEVAAIKDIGNYFD
RAEYIRWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEQVKGPDHEKYLWTS
AAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEVMIPETRE
FEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDN
PGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgtctgttaccacagaaaacgcccctgttcaggggcaaaccacgctgcaggaaaatagg
gcgggcgagggcgtttacgcctcgctgtttgaaaaaattaatctcgccccggcgtctcac
ctcggggatatcaacgactttctggacgatgccgcgctctccgaagcgccggcggcggag
cgtctcaccgcggcgatgcaggtgtttatggatcgcatccgtcagtccggtcagcgggtg
gaaaagctcgacaaaacgctgattgaccaccatatcgccgaactggatttccagataagc
cgtcagctggacgcggtgatgcaccatcaggagtttcagcaggtcgaatccctgtggcgc
ggcctcaaacagctggtggacaacaccgactatcggcagaacgtcaaaacggagatcctg
gacgtcgccaaagacgatctgcgccaggactttgaggacgcgccggagcttatccagagc
ggactctactggcacacctataccgcggagtatgacacccccggcggcgagccgatcggc
tcggtgatctcggcctatgagttcgacgccagcccgcaggatgtggcgctcctgcgcaat
atctcccgcgtctctgcggccgcccatatgccgtttatcggcgccgtcggcccggccttc
ttcctgaaagagaccatggaagaggtggctgccattaaggatatcggcaactacttcgat
cgcgcggaatatatccgctggaaatcatttcgtgaaaccgacgatgcccgctacatcggc
ctggtgatgccgcgtgtgctgggtcgtctaccgtacggtccggacaccgtgccggtgcgc
agcttcaactatgtcgagcaggtgaagggcccggaccacgaaaaatatctctggaccagc
gcggcgttctccttcgcatccaatatggtgaagagctttgtcaataacggctggtgcgtg
caaattcgcggtccgcaggccggcggcgcggtgaaagatctgcccatccatctgtacgat
ctgggcaccggcaaccaggtgaaaattccttccgaggtgatgatcccggaaacgcgggag
tttgagttcgccagcctgggctttatcccgctgtcgtactacaaaaatcgcgattacgcc
tgcttcttctcggccaactccgcgcagaaaccggcgctgtacgataccgccgacgccacc
gccaacagccgcatcaacgcgcgtctgccttacatcttcctgctgtcgcgcatcgcgcac
tacctgaagatgatccagcgcgagaatatcggcaccaccaaggaccggcggctgctggag
ctggagctgaacacctgggtgcggagcctggtgactgaaatgaccgaccccggcgacgag
ctgcaggcctcccatccgctgcgcgatgccagcgtggtggtggaagatattgaggataac
ccgggcttcttccgcgtgaagctgtacgcggtgccgcacttccaggtcgaggggatggac
gtcaatctgtcgctggttagccagatgccaaaggcgaaggcgtag

DBGET integrated database retrieval system