KEGG   Klebsiella pneumoniae 342: KPK_3183Help
Entry
KPK_3183          CDS       T00772                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00260  Glycine, serine and threonine metabolism
kpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01130  Biosynthesis of antibiotics
kpe01230  Biosynthesis of amino acids
Module
kpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPK_3183 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPK_3183 (trpA)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KPK_3183 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACI10524
UniProt: B5XT03
Position
3237693..3238502
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKNRQEGAFVPFVTLGDPGPEQSLKIIDALIEGGADALELGIPFSDPLAD
GPTIQGAALRAFAAGVTPAQCFEMLAAIRQKHPTIPIGLLMYANLVFSPGIDAFYAQCAR
VGVDSVLVADVPVEESAPFRQAAMRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLVEKLAEYHAAPPLQGFGISAPEQVSAAIDAGAAGAISGSAIVKI
IERHLDEPQTMLDELKAFVQSLKAATKTA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgagacgctgtttgcccaactgaaaaatcgccaggaaggcgccttcgtt
ccctttgtcaccctcggcgatccgggaccggagcagtcgctcaaaattatcgatgcgctg
atcgaaggcggcgccgatgcccttgagctggggatccctttctccgacccgctggcggac
ggcccgaccatccagggcgcggccctgcgcgccttcgccgcgggagtgaccccggcgcag
tgctttgagatgctggcggcgatccgccagaagcatccgaccatcccaatcggcctgctg
atgtacgccaacctcgtcttcagcccgggcatcgatgcgttctatgcccagtgcgcccgc
gtcggcgtcgactcggtgctggtagccgacgtgccggtggaagagtccgccccgttccgc
caggcggcgatgcgccataatatcgcgccgattttcatctgcccgcccaatgcggatgac
gatttactgcgccagattgcctcttatggccgcggctacacctatctgctgtcgcgcgcc
ggggtgaccggtgcggaaaatcgcgccgcgctgccgctgcaccacctggtggagaagctg
gcggaatatcacgccgcgccgccgctgcagggctttggtatctccgcgccggagcaggtg
agcgccgccattgacgccggagccgccggggctatctccggttccgccatcgtcaaaatc
atcgaacgccacctcgatgagccgcagaccatgctcgacgaactgaaagccttcgtccag
agcctgaaggcggcgaccaaaaccgcctga

DBGET integrated database retrieval system