KEGG   Klebsiella pneumoniae 342: KPK_3503Help
Entry
KPK_3503          CDS       T00772                                 

Definition
(GenBank) arginase family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00220  Arginine biosynthesis
kpe00330  Arginine and proline metabolism
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01130  Biosynthesis of antibiotics
kpe01230  Biosynthesis of amino acids
Module
kpe_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KPK_3503
   00330 Arginine and proline metabolism
    KPK_3503
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KPK_3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACI07455
UniProt: B5XXL4
Position
3521524..3522387
Genome map
AA seq 287 aa AA seqDB search
MTSKTLRLIFPQWQGGNNPPYYLGSQLLSFLSPEAKGPVEIVPVELPTTEPLPGINGITA
KPSLIRQLNNAAALIEKHDPNSIVILGGDCLVSLAPFAHLLDKFGDKLGVLWIDSHPDVQ
TAEQYPNAHAHVLGALMGTGDNDLVAHVKTKLNPSKIMIAGIHAPLPYEAEYLTRHNITT
LAPEQVKSGADEVLEWIAKEKIAYLAIHIDLDVLDPSLFRSILFAKPGRGKHDFGDVAEG
KLTIEDVLNLIAAATTKAVPVGLTIAEHLPWDMLNLKNMLSELPLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactagcaaaacactgcgacttatatttcctcaatggcaaggcggtaacaatcctccc
tactatcttggctcgcagctcctctcgtttctctctcctgaagcaaaagggcccgttgag
atcgttcctgttgagttaccaacaacagagccattgccagggattaatggcatcacggct
aagccatccctcatcaggcaactcaataatgctgccgcactgattgaaaaacatgatccc
aatagcattgtcattttaggcggagactgcctggtttcgctggcgcctttcgcccacctg
ctcgataagttcggagacaaactcggtgtgctctggattgactcgcatcctgacgtgcag
acggctgaacaatatccaaacgcgcatgcccatgtgcttggtgcgctaatgggtacgggt
gataacgatttagttgcccatgtaaaaaccaaacttaatccgtcaaaaataatgattgcc
ggtatccacgcgccacttccttatgaagctgaatacctcactcgccataacattacgacg
ctagcacctgaacaggttaaaagcggtgcagatgaagtcctggagtggatagctaaagaa
aagattgcgtatctggcgatccatatcgatctggacgtactcgacccatctctgttccgc
tccattctttttgcaaaaccggggcgcggaaaacacgattttggcgacgttgctgaaggc
aaactgacgattgaggatgtactcaatctgatagcggcagcgacgacaaaagcagtcccc
gttggcctgacaatcgctgaacatttgccctgggacatgctgaatctcaagaacatgctc
agtgaattaccccttctaaagtaa

DBGET integrated database retrieval system