KEGG   Klebsiella pneumoniae 342: KPK_3915Help
Entry
KPK_3915          CDS       T00772                                 

Definition
(GenBank) hydrolase, carbon-nitrogen family
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
kpe  Klebsiella pneumoniae 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPK_3915
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     KPK_3915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACI11652
UniProt: B5XZS8
Position
complement(3959614..3960402)
Genome map
AA seq 262 aa AA seqDB search
MRVAAGQFAVTPVWRTNAQTCVTMMQQAAREGAALLVLPEALLARDDNDPDMSVKSAQPL
DGAFLQLLLAESGRNRLTTVLTLHVPSAEGRATNTLVVLRDGEVIAHYHKLHLYDAFAMQ
ESRRVDPGQQIPPVIEVAGLRVGLMTCYDLRFPELALSLALNGAELLVLPTAWVRGPQKE
HHWATLLAARALDTTCYIVAAGECGTRNIGQSRIVDPLGTTLAGAGSEPQLIFADVSAEH
LARVRERLPVLQNRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtagcggcaggacaatttgccgtcacgccagtatggcggacgaatgcgcagacc
tgtgtgacgatgatgcaacaggctgcgcgtgaaggggcggcgctgctggtgctgccagag
gcgttactggcgcgagatgacaacgacccggatatgtcagtgaaatcggctcagccgctg
gatggggcgtttttgcagctgctgctggctgagagcgggcgtaaccgtttgaccacggtc
ctgacgctgcatgtgccgtcggcagaaggccgtgcgaccaatacgctggtggtcttgcgg
gatggcgaagtaatagcccattatcacaaactgcatttatacgacgccttcgcaatgcag
gagtcgcggcgggtggatcctggccagcagatcccgccggtaattgaagtggcggggtta
cgcgttggcctgatgacctgctacgatcttcgctttccggaactggccctatcgctggcg
ctgaacggagctgagctgctggtactgcccaccgcatgggtgagagggccacagaaagag
caccactgggcgacgctgttggcggcgcgcgcgctcgatacgacctgctatatcgtggcg
gcaggcgaatgcgggacgcggaatattggtcagagccgcattgtagacccgctgggaacg
acgctggcgggggccgggagcgaaccgcagctgatctttgccgatgtctccgcagagcac
cttgcgcgggttcgcgagcgtttgccggtactgcagaaccgacgatttgcgccaccgcaa
ttattgtga

DBGET integrated database retrieval system